Diaphorina citri psyllid: psy17150


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
RPLTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEGYQEFGH
cccccccccccccccHHHHHHHHcccccccccccccccEEEEEEEEccccccccCEEEEEEEccccEEEEECccccccccEEEEccccEEEEEcccccccccccccEEEEECcccEEEEEcccHHHHHHHHHHHHHHHHccccccc
***TRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYY*****K*QRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEG******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RPLTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEGYQEFGH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pleckstrin homology-like domain family B member 1 confidentQ86UU1
Pleckstrin homology-like domain family B member 1 (Fragment) confidentQ63312
Pleckstrin homology-like domain family B member 2 Seems to be involved in the assembly of the postsynaptic apparatus. May play a role in acetyl-choline receptor (AChR) aggregation in the postsynaptic membrane.confidentQ8K1N2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045111 [CC]intermediate filament cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V5U, chain A
Confidence level:very confident
Coverage over the Query: 36-142
View the alignment between query and template
View the model in PyMOL
Template: 3LJU, chain X
Confidence level:confident
Coverage over the Query: 6-140
View the alignment between query and template
View the model in PyMOL