Psyllid ID: psy17150
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 146 | ||||||
| 242005130 | 191 | grb2-associated binder, gab, putative [P | 1.0 | 0.764 | 0.719 | 2e-63 | |
| 321473840 | 1563 | hypothetical protein DAPPUDRAFT_314338 [ | 0.986 | 0.092 | 0.694 | 3e-59 | |
| 91079552 | 1201 | PREDICTED: similar to pleckstrin homolog | 1.0 | 0.121 | 0.650 | 1e-58 | |
| 350399253 | 1404 | PREDICTED: hypothetical protein LOC10074 | 1.0 | 0.103 | 0.664 | 6e-58 | |
| 340709972 | 1404 | PREDICTED: hypothetical protein LOC10064 | 1.0 | 0.103 | 0.664 | 8e-58 | |
| 380028149 | 1395 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.104 | 0.650 | 2e-57 | |
| 307176563 | 1344 | Pleckstrin-like proteiny-like domain fam | 1.0 | 0.108 | 0.657 | 2e-57 | |
| 322795540 | 1242 | hypothetical protein SINV_06862 [Solenop | 1.0 | 0.117 | 0.657 | 3e-57 | |
| 328780553 | 1426 | PREDICTED: hypothetical protein LOC41089 | 1.0 | 0.102 | 0.650 | 4e-57 | |
| 383861685 | 1387 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.105 | 0.650 | 6e-57 |
| >gi|242005130|ref|XP_002423426.1| grb2-associated binder, gab, putative [Pediculus humanus corporis] gi|212506495|gb|EEB10688.1| grb2-associated binder, gab, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 246 bits (629), Expect = 2e-63, Method: Compositional matrix adjust.
Identities = 105/146 (71%), Positives = 131/146 (89%)
Query: 1 RPLTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFV 60
RPLTRYLP + +SL+LRQHIE+AGHQ++ C H+ +D+TSCRG L+K+ G+FHHWNKRWFV
Sbjct: 44 RPLTRYLPIKSESLNLRQHIESAGHQVDLCPHVFIDSTSCRGILHKLGGKFHHWNKRWFV 103
Query: 61 FDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLM 120
FDRT R+L YY D++EKKQRG TYF+ IEEVYVDHLNSVKSP+PH+TFV+K+ +RT++LM
Sbjct: 104 FDRTKRTLTYYMDKTEKKQRGGTYFQAIEEVYVDHLNSVKSPNPHVTFVIKTHERTYYLM 163
Query: 121 APSAEAMRIWIDVIFSGAEGYQEFGH 146
AP+ EAMRIW+DVIF+GAEGYQEF H
Sbjct: 164 APNPEAMRIWVDVIFTGAEGYQEFEH 189
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321473840|gb|EFX84806.1| hypothetical protein DAPPUDRAFT_314338 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|91079552|ref|XP_971453.1| PREDICTED: similar to pleckstrin homology-like domain, family B, member 2 [Tribolium castaneum] gi|270004447|gb|EFA00895.1| hypothetical protein TcasGA2_TC003799 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|350399253|ref|XP_003485469.1| PREDICTED: hypothetical protein LOC100749943 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340709972|ref|XP_003393573.1| PREDICTED: hypothetical protein LOC100642833 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|380028149|ref|XP_003697771.1| PREDICTED: uncharacterized protein LOC100871905 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307176563|gb|EFN66050.1| Pleckstrin-like proteiny-like domain family B member 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322795540|gb|EFZ18236.1| hypothetical protein SINV_06862 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|328780553|ref|XP_394371.4| PREDICTED: hypothetical protein LOC410895 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383861685|ref|XP_003706315.1| PREDICTED: uncharacterized protein LOC100881980 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 146 | ||||||
| UNIPROTKB|E9PKC1 | 417 | PHLDB1 "Pleckstrin homology-li | 0.986 | 0.345 | 0.586 | 3.4e-45 | |
| UNIPROTKB|E9PMZ5 | 509 | PHLDB1 "Pleckstrin homology-li | 0.986 | 0.282 | 0.586 | 3.4e-45 | |
| ZFIN|ZDB-GENE-091118-9 | 1197 | si:ch211-244c8.3 "si:ch211-244 | 0.986 | 0.120 | 0.613 | 4.8e-45 | |
| UNIPROTKB|D4A5C1 | 565 | LOC360713 "Protein LOC360713" | 0.986 | 0.254 | 0.572 | 9.1e-45 | |
| UNIPROTKB|F1LQQ9 | 781 | Phldb1 "Pleckstrin homology-li | 0.986 | 0.184 | 0.586 | 3e-44 | |
| ZFIN|ZDB-GENE-030131-3235 | 1361 | si:dkey-11p10.8 "si:dkey-11p10 | 0.986 | 0.105 | 0.586 | 3.5e-44 | |
| RGD|620878 | 831 | Phldb1 "pleckstrin homology-li | 0.986 | 0.173 | 0.586 | 4.1e-44 | |
| UNIPROTKB|G3N336 | 1371 | PHLDB1 "Uncharacterized protei | 0.986 | 0.105 | 0.586 | 7.4e-44 | |
| UNIPROTKB|E9PGF6 | 744 | PHLDB2 "Uncharacterized protei | 0.986 | 0.193 | 0.565 | 7.9e-44 | |
| UNIPROTKB|E2RMC8 | 1490 | PHLDB1 "Uncharacterized protei | 0.986 | 0.096 | 0.586 | 8.7e-44 |
| UNIPROTKB|E9PKC1 PHLDB1 "Pleckstrin homology-like domain family B member 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 475 (172.3 bits), Expect = 3.4e-45, P = 3.4e-45
Identities = 85/145 (58%), Positives = 108/145 (74%)
Query: 1 RPLTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFV 60
RPLTRYLP R + DL+ HIE++GH ++ C H+ L + CRGYL KM G+ W KRWFV
Sbjct: 271 RPLTRYLPIRKEDFDLKTHIESSGHGVDTCLHVVLSSKVCRGYLVKMGGKIKSWKKRWFV 330
Query: 61 FDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSV-KSPSPHLTFVVKSSDRTFHL 119
FDR R+L+YY D+ E K +G YF+ IEEVY DHL S KSP+P LTF VK+ DR +++
Sbjct: 331 FDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLRSAAKSPNPALTFCVKTHDRLYYM 390
Query: 120 MAPSAEAMRIWIDVIFSGAEGYQEF 144
+APSAEAMRIW+DVI +GAEGY +F
Sbjct: 391 VAPSAEAMRIWMDVIVTGAEGYTQF 415
|
|
| UNIPROTKB|E9PMZ5 PHLDB1 "Pleckstrin homology-like domain family B member 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-091118-9 si:ch211-244c8.3 "si:ch211-244c8.3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A5C1 LOC360713 "Protein LOC360713" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LQQ9 Phldb1 "Pleckstrin homology-like domain family B member 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-3235 si:dkey-11p10.8 "si:dkey-11p10.8" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|620878 Phldb1 "pleckstrin homology-like domain, family B, member 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N336 PHLDB1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PGF6 PHLDB2 "Uncharacterized protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RMC8 PHLDB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 146 | |||
| cd01235 | 106 | cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als | 4e-35 | |
| cd13282 | 96 | cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology | 6e-14 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 1e-10 | |
| cd01265 | 101 | cd01265, PH_TBC1D2A, TBC1 domain family member 2A | 4e-09 | |
| cd13324 | 103 | cd13324, PH_Gab-like, Grb2-associated binding prot | 9e-09 | |
| cd13255 | 110 | cd13255, PH_TAAP2-like, Tandem PH-domain-containin | 1e-08 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 1e-08 | |
| cd13298 | 106 | cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin | 1e-08 | |
| cd10573 | 96 | cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin | 2e-08 | |
| cd13385 | 125 | cd13385, PH_Gab3, Grb2-associated binding protein | 4e-08 | |
| cd13384 | 115 | cd13384, PH_Gab2_2, Grb2-associated binding protei | 1e-07 | |
| cd13248 | 104 | cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate | 3e-07 | |
| cd13263 | 114 | cd13263, PH_RhoGap25-like, Rho GTPase activating p | 3e-06 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 3e-06 | |
| cd13273 | 110 | cd13273, PH_SWAP-70, Switch-associated protein-70 | 4e-06 | |
| cd01266 | 123 | cd01266, PH_Gab1_Gab2, Grb2-associated binding pro | 5e-06 | |
| cd13291 | 107 | cd13291, PH_ORP10_ORP11, Human Oxysterol binding p | 5e-06 | |
| cd13379 | 114 | cd13379, PH_RhoGap24, Rho GTPase activating protei | 2e-05 | |
| cd13290 | 102 | cd13290, PH_ORP9, Human Oxysterol binding protein | 2e-05 | |
| cd13250 | 98 | cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin | 4e-05 | |
| cd13276 | 117 | cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin | 6e-05 | |
| cd13253 | 93 | cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, anky | 8e-05 | |
| cd01238 | 140 | cd01238, PH_Btk, Bruton's tyrosine kinase pleckstr | 1e-04 | |
| cd13270 | 118 | cd13270, PH1_TAPP1_2, Tandem PH-domain-containing | 2e-04 | |
| cd13215 | 130 | cd13215, PH-GRAM1_AGT26, Autophagy-related protein | 4e-04 | |
| cd01251 | 105 | cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple | 4e-04 | |
| cd13296 | 111 | cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P | 4e-04 | |
| cd01252 | 118 | cd01252, PH_GRP1-like, General Receptor for Phosph | 0.002 | |
| cd13288 | 120 | cd13288, PH_Ses, Sesquipedalian family Pleckstrin | 0.002 | |
| cd13378 | 116 | cd13378, PH_RhoGAP2, Rho GTPase activating protein | 0.002 | |
| cd13297 | 123 | cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin h | 0.003 |
| >gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
Score = 117 bits (295), Expect = 4e-35
Identities = 39/103 (37%), Positives = 55/103 (53%), Gaps = 2/103 (1%)
Query: 39 SCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHL-- 96
+C GYL K W +RWFV D T L YY + + K +G + +E VY D
Sbjct: 4 TCEGYLYKRGALLKGWKQRWFVLDLTKHQLRYYESKEDTKCKGVIDLQEVESVYPDTPSI 63
Query: 97 NSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAE 139
+ KSP P F +K++ R ++ +APSAEA + WIDVI +
Sbjct: 64 GAPKSPDPGAFFELKTNKRVYYFLAPSAEAAQQWIDVIQTLLS 106
|
Sbf1 is a myotubularin-related pseudo-phosphatase. Both Sbf1 and myotubularin interact with the SET domains of Hrx and other epigenetic regulatory proteins, but Sbf1 lacks phosphatase activity due to several amino acid changes in its structurally preserved catalytic pocket. It contains pleckstrin (PH), GEF, and myotubularin homology domains that are thought to be responsible for signaling and growth control. Sbf1 functions as an inhibitor of cellular growth. The N-terminal GEF homology domain serves to inhibit the transforming effects of Sbf1. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 106 |
| >gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241478 cd13324, PH_Gab-like, Grb2-associated binding protein family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241536 cd13385, PH_Gab3, Grb2-associated binding protein 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241535 cd13384, PH_Gab2_2, Grb2-associated binding protein family pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241297 cd01266, PH_Gab1_Gab2, Grb2-associated binding proteins 1 and 2 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241445 cd13291, PH_ORP10_ORP11, Human Oxysterol binding protein (OSBP) related proteins 10 and 11 (ORP10 and ORP11) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241444 cd13290, PH_ORP9, Human Oxysterol binding protein related protein 9 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241424 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, N-terminal repeat | Back alignment and domain information |
|---|
| >gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH) domain, repeat 3 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.94 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.94 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 99.93 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.92 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.92 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.92 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.91 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.91 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.9 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 99.9 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.89 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 99.89 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.87 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 99.86 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 99.86 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 99.86 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.83 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 99.81 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 99.79 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 99.77 | |
| KOG0930|consensus | 395 | 99.76 | ||
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 99.75 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 99.72 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 99.71 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 99.71 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 99.69 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 99.68 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 99.67 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 99.62 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 99.59 | |
| KOG1090|consensus | 1732 | 99.59 | ||
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 99.56 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 99.55 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 99.52 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 99.46 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 99.46 | |
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 99.34 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 99.23 | |
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 99.16 | |
| KOG0690|consensus | 516 | 99.16 | ||
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 99.14 | |
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 99.11 | |
| KOG2059|consensus | 800 | 99.09 | ||
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 99.08 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 99.04 | |
| KOG3640|consensus | 1116 | 99.03 | ||
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 99.0 | |
| KOG3751|consensus | 622 | 98.92 | ||
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 98.87 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 98.8 | |
| cd01240 | 116 | PH_beta-ARK Beta adrenergic receptor kinase 1(beta | 98.73 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 98.68 | |
| KOG1117|consensus | 1186 | 98.64 | ||
| KOG0521|consensus | 785 | 98.58 | ||
| KOG0248|consensus | 936 | 98.48 | ||
| PLN02866 | 1068 | phospholipase D | 98.47 | |
| KOG0932|consensus | 774 | 98.47 | ||
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 98.46 | |
| KOG1739|consensus | 611 | 98.42 | ||
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 98.4 | |
| KOG1117|consensus | 1186 | 98.35 | ||
| KOG3531|consensus | 1036 | 98.32 | ||
| KOG3723|consensus | 851 | 98.26 | ||
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 98.24 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 98.22 | |
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 98.19 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 98.15 | |
| KOG4424|consensus | 623 | 98.14 | ||
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 98.03 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 97.98 | |
| cd01248 | 115 | PH_PLC Phospholipase C (PLC) pleckstrin homology ( | 97.95 | |
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 97.82 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 97.6 | |
| KOG1451|consensus | 812 | 97.53 | ||
| KOG3543|consensus | 1218 | 97.46 | ||
| PF15408 | 104 | PH_7: Pleckstrin homology domain | 97.44 | |
| cd01228 | 96 | PH_BCR-related BCR (breakpoint cluster region)-rel | 97.3 | |
| KOG4236|consensus | 888 | 97.27 | ||
| PF15404 | 185 | PH_4: Pleckstrin homology domain | 97.07 | |
| PF15405 | 135 | PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. | 97.03 | |
| KOG1737|consensus | 799 | 96.74 | ||
| KOG0592|consensus | 604 | 96.72 | ||
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 96.72 | |
| KOG3551|consensus | 506 | 96.65 | ||
| KOG3549|consensus | 505 | 96.41 | ||
| cd01227 | 133 | PH_Dbs Dbs (DBL's big sister) pleckstrin homology | 96.17 | |
| PF15411 | 116 | PH_10: Pleckstrin homology domain | 96.03 | |
| KOG4424|consensus | 623 | 95.49 | ||
| KOG4807|consensus | 593 | 95.29 | ||
| KOG1738|consensus | 638 | 95.24 | ||
| cd01255 | 160 | PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM | 95.08 | |
| KOG4047|consensus | 429 | 93.97 | ||
| KOG0248|consensus | 936 | 93.89 | ||
| KOG0705|consensus | 749 | 93.77 | ||
| KOG1264|consensus | 1267 | 92.81 | ||
| KOG3523|consensus | 695 | 92.38 | ||
| PF08458 | 110 | PH_2: Plant pleckstrin homology-like region; Inter | 91.36 | |
| KOG3727|consensus | 664 | 91.21 | ||
| KOG4407|consensus | 1973 | 87.02 | ||
| KOG3551|consensus | 506 | 86.9 | ||
| cd05394 | 313 | RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the | 83.54 | |
| KOG2070|consensus | 661 | 82.76 | ||
| cd05128 | 315 | RasGAP_GAP1_like The GAP1 family of Ras GTPase-act | 82.56 | |
| PF15277 | 91 | Sec3-PIP2_bind: Exocyst complex component SEC3 N-t | 80.91 |
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.3e-25 Score=145.84 Aligned_cols=98 Identities=20% Similarity=0.267 Sum_probs=82.0
Q ss_pred ceEEEEEEeecCCCCCceeeEEEEEcCCCEEEEEeCCCCccccceEEcccceEEEecCCCCCCCCCCCeEEEEEeCCeEE
Q psy17150 38 TSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTF 117 (146)
Q Consensus 38 ~~~~G~L~k~~~~~~~Wk~r~fvL~~~~~~L~yy~~~~~~~~~g~i~L~~~~~v~~~~~~~~~~~~~~~~f~i~t~~r~~ 117 (146)
++++|||.|+++..+.|++|||||+ ++.|+||+++.+..+.|.|+|..+....... ..+..++.++|.|.+++++|
T Consensus 2 v~k~G~L~Kkg~~~k~WkkRwfvL~--~~~L~yyk~~~~~~~~~~I~L~~~~v~~~~~--~~~~~~~~~~F~I~t~~rt~ 77 (100)
T cd01233 2 VSKKGYLNFPEETNSGWTRRFVVVR--RPYLHIYRSDKDPVERGVINLSTARVEHSED--QAAMVKGPNTFAVCTKHRGY 77 (100)
T ss_pred cceeEEEEeeCCCCCCcEEEEEEEE--CCEEEEEccCCCccEeeEEEecccEEEEccc--hhhhcCCCcEEEEECCCCEE
Confidence 4599999999998899999999999 8999999999999999999999654332211 11122346899999999999
Q ss_pred EEECCCHHHHHHHHHHHHHhhh
Q psy17150 118 HLMAPSAEAMRIWIDVIFSGAE 139 (146)
Q Consensus 118 ~l~a~s~~e~~~Wi~al~~~~~ 139 (146)
+|+|+|++|+++||++|+.+..
T Consensus 78 ~~~A~s~~e~~~Wi~ai~~~~~ 99 (100)
T cd01233 78 LFQALSDKEMIDWLYALNPLYA 99 (100)
T ss_pred EEEcCCHHHHHHHHHHhhhhhc
Confidence 9999999999999999987654
|
Unc-104 pleckstrin homology (PH) domain. Unc-104 is a kinesin-like protein containing an N-terminal kinesin catalytic domain, followed by a forkhead associated domain with a C-terminal PH domain. These proteins are responsible for the transport of membrane vesicles along microtubules. The mechanism involves the binding of the PH domain to phosphatidiylinositol (4,5) P2-containing liposomes. |
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0930|consensus | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1090|consensus | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3640|consensus | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1117|consensus | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >KOG0248|consensus | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >KOG0932|consensus | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1739|consensus | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >KOG1117|consensus | Back alignment and domain information |
|---|
| >KOG3531|consensus | Back alignment and domain information |
|---|
| >KOG3723|consensus | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4424|consensus | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG3543|consensus | Back alignment and domain information |
|---|
| >PF15408 PH_7: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4236|consensus | Back alignment and domain information |
|---|
| >PF15404 PH_4: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A | Back alignment and domain information |
|---|
| >KOG1737|consensus | Back alignment and domain information |
|---|
| >KOG0592|consensus | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3551|consensus | Back alignment and domain information |
|---|
| >KOG3549|consensus | Back alignment and domain information |
|---|
| >cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15411 PH_10: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG4424|consensus | Back alignment and domain information |
|---|
| >KOG4807|consensus | Back alignment and domain information |
|---|
| >KOG1738|consensus | Back alignment and domain information |
|---|
| >cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4047|consensus | Back alignment and domain information |
|---|
| >KOG0248|consensus | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG3727|consensus | Back alignment and domain information |
|---|
| >KOG4407|consensus | Back alignment and domain information |
|---|
| >KOG3551|consensus | Back alignment and domain information |
|---|
| >cd05394 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the GAP1 family of Ras GTPase-activating proteins that includes GAP1_IP4BP (or RASA3), CAPRI, and RASAL | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >cd05128 RasGAP_GAP1_like The GAP1 family of Ras GTPase-activating proteins includes GAP1(m) (or RASA2), GAP1_IP4BP (or RASA3), Ca2+ -promoted Ras inactivator (CAPRI, or RASAL4), and Ras GTPase activating-like proteins (RASAL) or RASAL1 | Back alignment and domain information |
|---|
| >PF15277 Sec3-PIP2_bind: Exocyst complex component SEC3 N-terminal PIP2 binding PH; PDB: 3HIE_D 3A58_E | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 146 | ||||
| 3tfm_A | 228 | Myosin X Ph1n-Ph2-Ph1c Tandem Length = 228 | 4e-06 | ||
| 1v5u_A | 117 | Solution Structure Of The C-Terminal Pleckstrin Hom | 1e-05 | ||
| 2dn6_A | 115 | Solution Structure Of The Ph Domain Of Kiaa0640 Pro | 3e-04 |
| >pdb|3TFM|A Chain A, Myosin X Ph1n-Ph2-Ph1c Tandem Length = 228 | Back alignment and structure |
|
| >pdb|1V5U|A Chain A, Solution Structure Of The C-Terminal Pleckstrin Homology Domain Of Sbf1 From Mouse Length = 117 | Back alignment and structure |
| >pdb|2DN6|A Chain A, Solution Structure Of The Ph Domain Of Kiaa0640 Protein From Human Length = 115 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 146 | |||
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 3e-34 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 2e-25 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 9e-25 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 3e-24 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 3e-23 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 6e-23 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 3e-22 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 2e-21 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 1e-20 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 7e-19 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 1e-18 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 2e-18 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 2e-18 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 4e-18 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 6e-18 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 7e-18 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 3e-17 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 3e-16 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 8e-16 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 9e-16 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 1e-15 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 1e-15 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 1e-15 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 7e-15 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 8e-15 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 1e-14 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 1e-14 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 3e-13 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 7e-13 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 5e-12 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 6e-12 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 1e-11 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 1e-11 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 2e-11 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 4e-11 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 2e-10 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 8e-10 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 1e-09 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 2e-09 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 3e-09 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 5e-09 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 6e-09 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 1e-08 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 7e-08 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 1e-07 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 4e-07 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 1e-06 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 1e-06 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 3e-06 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 3e-06 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 4e-06 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 5e-06 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 5e-06 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 3e-05 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 4e-05 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 9e-05 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 9e-05 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 1e-04 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 3e-04 |
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
Score = 114 bits (288), Expect = 3e-34
Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 2/98 (2%)
Query: 39 SCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDH--L 96
S G L K W RWFV D+T L YY R + + +G +E V +
Sbjct: 9 SYEGILYKKGAFMKPWKARWFVLDKTKHQLRYYDHRMDTECKGVIDLAEVEAVAPGTPTI 68
Query: 97 NSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
+ K+ F VK++ R ++ A + + W+D I
Sbjct: 69 GAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDRI 106
|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Length = 256 | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Length = 151 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Length = 224 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.94 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.93 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.93 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.93 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.93 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.93 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.92 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.92 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.92 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.92 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.92 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.92 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.92 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.92 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.92 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.92 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.92 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.92 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.92 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.92 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.92 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.92 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.91 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.91 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.91 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.91 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.91 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.91 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.91 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.91 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.91 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.9 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.9 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.9 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.9 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.89 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.89 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.89 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.88 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.88 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.88 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.88 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.87 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.87 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.87 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.87 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.87 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.86 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.85 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 99.85 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 99.84 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.83 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.83 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 99.82 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 99.82 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 99.82 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.81 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 99.8 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 99.79 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 99.78 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 99.75 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 99.73 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.73 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 99.7 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 99.64 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 99.64 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.62 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 99.6 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 99.59 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 99.57 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 99.56 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 99.2 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 98.97 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 98.77 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 98.69 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 98.6 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 98.57 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 98.22 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 98.17 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 98.16 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 98.13 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 98.12 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 98.01 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 97.98 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 97.98 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 97.95 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 97.93 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 97.9 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 97.83 | |
| 2z0q_A | 346 | XPLN, RHO guanine nucleotide exchange factor 3; DH | 97.8 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 97.77 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 97.76 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 97.75 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 97.73 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 97.68 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 97.65 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 97.64 | |
| 1foe_A | 377 | T-lymphoma invasion and metastasis inducing protei | 97.47 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 97.43 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 96.89 | |
| 2adz_A | 178 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 96.77 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 96.71 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 96.54 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 96.32 | |
| 1fho_A | 119 | UNC-89; pleckstrin homology domain, electrostatics | 95.95 | |
| 3a98_B | 203 | Engulfment and cell motility protein 1; protein-pr | 94.49 | |
| 3hie_A | 171 | Protein PSL1, exocyst complex component SEC3; PH d | 90.12 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 87.33 | |
| 3ulb_A | 121 | Target of rapamycin complex 2 subunit AVO1; PH dom | 86.58 |
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
Probab=99.94 E-value=4.9e-26 Score=156.49 Aligned_cols=105 Identities=12% Similarity=0.184 Sum_probs=88.1
Q ss_pred cCCCCCCCCceEEEEEEeecCCCCCceeeEEEEEcCCCEEEEEeCCCCccccceEEcccceEEEecCCCCCCCCCCCeEE
Q psy17150 29 ACSHLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTF 108 (146)
Q Consensus 29 ~~~~~~~~~~~~~G~L~k~~~~~~~Wk~r~fvL~~~~~~L~yy~~~~~~~~~g~i~L~~~~~v~~~~~~~~~~~~~~~~f 108 (146)
........+++++|||.|+|+..+.|++|||||+ ++.|+||+++.+..+.|.|+|..+..+...... ..+.++|
T Consensus 9 ~~~~~~~~pv~keG~L~Kkg~~~k~WkrRWFvLk--~~~L~Yyk~~~d~~~~g~I~L~~~~~~~~~~~~----~~~~~~F 82 (149)
T 1x1f_A 9 ERLKITALPLYFEGFLLIKRSGYREYEHYWTELR--GTTLFFYTDKKSIIYVDKLDIVDLTCLTEQNST----EKNCAKF 82 (149)
T ss_dssp CCCSCSSSCEEEEEEEEEECTTCCSCEEEEEEEE--TTEEEEESCSSCSSCSEECCCSSCCEEEECCCT----TSCCCEE
T ss_pred hcccCCCCCccEEEEEEEeCCCCCCceeEEEEEc--CCEEEEEeCCCccccCcEEECCCceEEeeccCC----CCcCcEE
Confidence 3444445557799999999998899999999999 899999999999999999999998765332111 1235899
Q ss_pred EEEeCCeEEEEECCCHHHHHHHHHHHHHhhh
Q psy17150 109 VVKSSDRTFHLMAPSAEAMRIWIDVIFSGAE 139 (146)
Q Consensus 109 ~i~t~~r~~~l~a~s~~e~~~Wi~al~~~~~ 139 (146)
.|.+++++|+|+|+|.+|+++||++|++++.
T Consensus 83 ~I~t~~r~~~f~A~s~ee~~eWi~aI~~v~~ 113 (149)
T 1x1f_A 83 TLVLPKEEVQLKTENTESGEEWRGFILTVTE 113 (149)
T ss_dssp EEECSSCCEEEECSSHHHHHHHHHHHHHHHH
T ss_pred EEEcCCCEEEEEcCCHHHHHHHHHHHHHHHc
Confidence 9999999999999999999999999998865
|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3a98_B Engulfment and cell motility protein 1; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} PDB: 2vsz_A | Back alignment and structure |
|---|
| >3hie_A Protein PSL1, exocyst complex component SEC3; PH domain, dimer, domain swapping, phosphate-binding, coiled coil, exocytosis; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ulb_A Target of rapamycin complex 2 subunit AVO1; PH domain, membrane localization, membrane protein; 1.90A {Saccharomyces cerevisiae} PDB: 3ulc_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 146 | ||||
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 5e-17 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 1e-15 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 3e-14 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 3e-14 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 4e-14 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 1e-13 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 2e-13 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 3e-12 | |
| d1qqga1 | 103 | b.55.1.2 (A:12-114) Insulin receptor substrate 1, | 4e-12 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 5e-12 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 3e-11 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 4e-11 | |
| d2coca1 | 99 | b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont | 1e-10 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 5e-10 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 6e-10 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 6e-10 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 8e-10 | |
| d1v5pa_ | 126 | b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: | 3e-09 | |
| d1maia_ | 119 | b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus | 1e-08 | |
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 2e-08 | |
| d2fjla1 | 101 | b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph | 2e-08 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 5e-08 | |
| d1x1fa1 | 136 | b.55.1.1 (A:8-143) Signal-transducing adaptor prot | 6e-08 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 1e-07 | |
| d1wgqa_ | 109 | b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin | 1e-07 | |
| d1w1ha_ | 147 | b.55.1.1 (A:) 3-phosphoinositide dependent protein | 2e-07 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 3e-07 | |
| d2cofa1 | 95 | b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) | 4e-07 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 5e-07 | |
| d2dyna_ | 111 | b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId | 2e-06 | |
| d2coaa1 | 112 | b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma | 5e-06 | |
| d1omwa2 | 119 | b.55.1.1 (A:550-668) G-protein coupled receptor ki | 8e-06 | |
| d1btna_ | 106 | b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), | 9e-06 | |
| d1wjma_ | 123 | b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), | 3e-05 | |
| d1wg7a_ | 150 | b.55.1.1 (A:) Dedicator of cytokinesis protein 9, | 4e-05 | |
| d2elba2 | 101 | b.55.1.1 (A:274-374) DCC-interacting protein 13-al | 2e-04 | |
| d1ki1b2 | 142 | b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( | 0.003 |
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: Src-associated adaptor protein Skap2 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 71.9 bits (175), Expect = 5e-17
Identities = 23/129 (17%), Positives = 38/129 (29%), Gaps = 7/129 (5%)
Query: 10 RGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGR----FHHWNKRWFVFDRTS 65
+ D + G+Q + L GYL K W KRW +T
Sbjct: 76 ASERYDKDDDGPSDGNQFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTV 135
Query: 66 RSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAE 125
YY +K+Q+G + + L + R + A S +
Sbjct: 136 --FYYYGSDKDKQQKGEFAIDGYDVRMNNTLRK-DGKKDCCFEICAPDKRIYQFTAASPK 192
Query: 126 AMRIWIDVI 134
W+ +
Sbjct: 193 DAEEWVQQL 201
|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 119 | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.93 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.93 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.92 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.91 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.91 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.9 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.9 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.9 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.9 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.89 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.89 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.89 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 99.89 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.89 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.89 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.88 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.88 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 99.87 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.87 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.87 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.87 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.86 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.86 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 99.85 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.85 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.85 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.79 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 99.79 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 99.78 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 99.37 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 99.28 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 99.25 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 99.14 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 98.81 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 98.8 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 98.44 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 98.41 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 98.34 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 98.2 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 98.13 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 98.0 | |
| d2zkmx3 | 131 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 97.83 | |
| d1foea2 | 162 | GEF of TIAM1 (T-Lymphoma invasion and metastasis i | 95.3 | |
| d1zsqa1 | 125 | Myotubularin-related protein 2, N-terminal domain | 90.16 |
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: Protein kinase c, d2 type species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=6e-26 Score=147.45 Aligned_cols=98 Identities=13% Similarity=0.211 Sum_probs=84.2
Q ss_pred eEEEEEEeecCCCCCceeeEEEEEcCCCEEEEEeCCCCccccceEEcccceEEEecCC-CCCCCCCCCeEEEEEeCCeEE
Q psy17150 39 SCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHL-NSVKSPSPHLTFVVKSSDRTF 117 (146)
Q Consensus 39 ~~~G~L~k~~~~~~~Wk~r~fvL~~~~~~L~yy~~~~~~~~~g~i~L~~~~~v~~~~~-~~~~~~~~~~~f~i~t~~r~~ 117 (146)
+++|||.|+++..+.|++|||||+ ++.|+||+++.+..|+|.|+|..+..+..... .........++|+|.|++++|
T Consensus 2 lk~GwL~k~~~~~~~wkkRwFvL~--~~~L~YYk~~~~~~p~g~I~L~~~~~v~~~~~~~~~~~~~~~~~F~I~T~~rty 79 (112)
T d2coaa1 2 LREGWVVHYSNKDTLRKRHYWRLD--CKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATY 79 (112)
T ss_dssp SEEEEEEECCSSSCCCEEEEEEEC--SSEEEEESSSSCSSCSEEEETTTCCEEEESCCCSSSCTTSCCEEEEEECSSCCC
T ss_pred ceEEEEEEECCCCCCeeEEEEEEE--cceEEEEeccCCCccceEEeeeccccccccccccccccCCCccEEEEEeCCeEE
Confidence 499999999998899999999999 89999999999999999999999888775332 222333456999999999999
Q ss_pred EEEC-----------CCHHHHHHHHHHHHHhh
Q psy17150 118 HLMA-----------PSAEAMRIWIDVIFSGA 138 (146)
Q Consensus 118 ~l~a-----------~s~~e~~~Wi~al~~~~ 138 (146)
||.+ ++++++++|+++|++|.
T Consensus 80 y~~~~~~~~~~~~s~~~~~~~~~W~~aI~~A~ 111 (112)
T d2coaa1 80 FVGEMPGGTPGGPSGQGAEAARGWETAIRQAL 111 (112)
T ss_dssp CEECCSCCCSSSCCCCCSHHHHHHHHHHHHHG
T ss_pred EEecCCccccccccccChHHHHHHHHHHHHhh
Confidence 9966 67888999999999975
|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zsqa1 b.55.1.8 (A:74-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|