Psyllid ID: psy17150


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
RPLTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEGYQEFGH
cccccccccccccccHHHHHHHHcccccccccccccccEEEEEEEEccccccccEEEEEEEEccccEEEEEEccccccccEEEEccccEEEEEcccccccccccccEEEEEEcccEEEEEcccHHHHHHHHHHHHHHHHHcccccc
cccccccccccccccHHHHHHHcccccccccEEEEcccccccEEEEcccEEcccccEEEEEEccccEEEEEcccccccccEEEEHHHHHHHHHHHccccccccccEEEEEEcccEEEEEEcccHHHHHHHHHHHHHcccccccccc
rpltrylpfrgdslDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAgrfhhwnkrwfvfdrtsrslayysdrsekkqrgatYFRCIEEVYVDHlnsvkspsphltfvvkssdrtfhlmapSAEAMRIWIDVIFSGaegyqefgh
rpltrylpfrgdSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRfhhwnkrwfvfdrTSRSLayysdrsekkqrgaTYFRCIEEVYVDHlnsvkspspHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEGYQEFGH
RPLTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEGYQEFGH
******LPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSD*****QRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEG******
***TRYLPFRGDSLDLRQ*************HLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLA*******K*QRGATYFRCIEEVYVDHLN**KSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGA*G******
RPLTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYY*********GATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEGYQEFGH
**LTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEGY*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RPLTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAEGYQEFGH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
Q63312831 Pleckstrin homology-like yes N/A 0.986 0.173 0.586 5e-49
Q8K1N21249 Pleckstrin homology-like yes N/A 0.986 0.115 0.572 7e-49
Q6PDH01371 Pleckstrin homology-like no N/A 0.986 0.105 0.586 8e-49
Q86SQ01253 Pleckstrin homology-like no N/A 0.986 0.114 0.565 1e-48
Q86UU11377 Pleckstrin homology-like yes N/A 0.986 0.104 0.538 2e-47
Q6NSJ2640 Pleckstrin homology-like no N/A 0.863 0.196 0.559 2e-38
D3ZJP6 2060 Unconventional myosin-X O no N/A 0.582 0.041 0.313 1e-05
Q9HD67 2058 Unconventional myosin-X O no N/A 0.582 0.041 0.323 2e-05
F8VQB6 2062 Unconventional myosin-X O no N/A 0.582 0.041 0.303 2e-05
P79114 2052 Unconventional myosin-X O no N/A 0.582 0.041 0.303 2e-05
>sp|Q63312|PHLB1_RAT Pleckstrin homology-like domain family B member 1 (Fragment) OS=Rattus norvegicus GN=Phldb1 PE=2 SV=2 Back     alignment and function desciption
 Score =  192 bits (489), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 85/145 (58%), Positives = 108/145 (74%), Gaps = 1/145 (0%)

Query: 1   RPLTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFV 60
           RPLTRYLP R +  DL+ HIE++GH ++ C H+ L +  CRGYL KM G+   W KRWFV
Sbjct: 685 RPLTRYLPNRKEDFDLKTHIESSGHGVDTCLHVVLSSKVCRGYLIKMGGKIKSWKKRWFV 744

Query: 61  FDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNS-VKSPSPHLTFVVKSSDRTFHL 119
           FDR  R+L+YY D+ E K +G  YF+ IEEVY DHL S  KSP+P LTF VK+ DR +++
Sbjct: 745 FDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLRSAAKSPNPALTFCVKTHDRLYYM 804

Query: 120 MAPSAEAMRIWIDVIFSGAEGYQEF 144
           +APSAEAMRIW+DVI +GAEGY +F
Sbjct: 805 VAPSAEAMRIWMDVIVTGAEGYTQF 829





Rattus norvegicus (taxid: 10116)
>sp|Q8K1N2|PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus GN=Phldb2 PE=1 SV=2 Back     alignment and function description
>sp|Q6PDH0|PHLB1_MOUSE Pleckstrin homology-like domain family B member 1 OS=Mus musculus GN=Phldb1 PE=1 SV=1 Back     alignment and function description
>sp|Q86SQ0|PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens GN=PHLDB2 PE=1 SV=2 Back     alignment and function description
>sp|Q86UU1|PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens GN=PHLDB1 PE=1 SV=1 Back     alignment and function description
>sp|Q6NSJ2|PHLB3_HUMAN Pleckstrin homology-like domain family B member 3 OS=Homo sapiens GN=PHLDB3 PE=2 SV=3 Back     alignment and function description
>sp|D3ZJP6|MYO10_RAT Unconventional myosin-X OS=Rattus norvegicus GN=Myo10 PE=1 SV=1 Back     alignment and function description
>sp|Q9HD67|MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens GN=MYO10 PE=1 SV=3 Back     alignment and function description
>sp|F8VQB6|MYO10_MOUSE Unconventional myosin-X OS=Mus musculus GN=Myo10 PE=1 SV=1 Back     alignment and function description
>sp|P79114|MYO10_BOVIN Unconventional myosin-X OS=Bos taurus GN=MYO10 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
242005130191 grb2-associated binder, gab, putative [P 1.0 0.764 0.719 2e-63
321473840 1563 hypothetical protein DAPPUDRAFT_314338 [ 0.986 0.092 0.694 3e-59
91079552 1201 PREDICTED: similar to pleckstrin homolog 1.0 0.121 0.650 1e-58
350399253 1404 PREDICTED: hypothetical protein LOC10074 1.0 0.103 0.664 6e-58
340709972 1404 PREDICTED: hypothetical protein LOC10064 1.0 0.103 0.664 8e-58
380028149 1395 PREDICTED: uncharacterized protein LOC10 1.0 0.104 0.650 2e-57
307176563 1344 Pleckstrin-like proteiny-like domain fam 1.0 0.108 0.657 2e-57
322795540 1242 hypothetical protein SINV_06862 [Solenop 1.0 0.117 0.657 3e-57
328780553 1426 PREDICTED: hypothetical protein LOC41089 1.0 0.102 0.650 4e-57
383861685 1387 PREDICTED: uncharacterized protein LOC10 1.0 0.105 0.650 6e-57
>gi|242005130|ref|XP_002423426.1| grb2-associated binder, gab, putative [Pediculus humanus corporis] gi|212506495|gb|EEB10688.1| grb2-associated binder, gab, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 105/146 (71%), Positives = 131/146 (89%)

Query: 1   RPLTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFV 60
           RPLTRYLP + +SL+LRQHIE+AGHQ++ C H+ +D+TSCRG L+K+ G+FHHWNKRWFV
Sbjct: 44  RPLTRYLPIKSESLNLRQHIESAGHQVDLCPHVFIDSTSCRGILHKLGGKFHHWNKRWFV 103

Query: 61  FDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLM 120
           FDRT R+L YY D++EKKQRG TYF+ IEEVYVDHLNSVKSP+PH+TFV+K+ +RT++LM
Sbjct: 104 FDRTKRTLTYYMDKTEKKQRGGTYFQAIEEVYVDHLNSVKSPNPHVTFVIKTHERTYYLM 163

Query: 121 APSAEAMRIWIDVIFSGAEGYQEFGH 146
           AP+ EAMRIW+DVIF+GAEGYQEF H
Sbjct: 164 APNPEAMRIWVDVIFTGAEGYQEFEH 189




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321473840|gb|EFX84806.1| hypothetical protein DAPPUDRAFT_314338 [Daphnia pulex] Back     alignment and taxonomy information
>gi|91079552|ref|XP_971453.1| PREDICTED: similar to pleckstrin homology-like domain, family B, member 2 [Tribolium castaneum] gi|270004447|gb|EFA00895.1| hypothetical protein TcasGA2_TC003799 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350399253|ref|XP_003485469.1| PREDICTED: hypothetical protein LOC100749943 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340709972|ref|XP_003393573.1| PREDICTED: hypothetical protein LOC100642833 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380028149|ref|XP_003697771.1| PREDICTED: uncharacterized protein LOC100871905 [Apis florea] Back     alignment and taxonomy information
>gi|307176563|gb|EFN66050.1| Pleckstrin-like proteiny-like domain family B member 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322795540|gb|EFZ18236.1| hypothetical protein SINV_06862 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|328780553|ref|XP_394371.4| PREDICTED: hypothetical protein LOC410895 [Apis mellifera] Back     alignment and taxonomy information
>gi|383861685|ref|XP_003706315.1| PREDICTED: uncharacterized protein LOC100881980 [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
UNIPROTKB|E9PKC1417 PHLDB1 "Pleckstrin homology-li 0.986 0.345 0.586 3.4e-45
UNIPROTKB|E9PMZ5509 PHLDB1 "Pleckstrin homology-li 0.986 0.282 0.586 3.4e-45
ZFIN|ZDB-GENE-091118-91197 si:ch211-244c8.3 "si:ch211-244 0.986 0.120 0.613 4.8e-45
UNIPROTKB|D4A5C1565 LOC360713 "Protein LOC360713" 0.986 0.254 0.572 9.1e-45
UNIPROTKB|F1LQQ9781 Phldb1 "Pleckstrin homology-li 0.986 0.184 0.586 3e-44
ZFIN|ZDB-GENE-030131-32351361 si:dkey-11p10.8 "si:dkey-11p10 0.986 0.105 0.586 3.5e-44
RGD|620878831 Phldb1 "pleckstrin homology-li 0.986 0.173 0.586 4.1e-44
UNIPROTKB|G3N3361371 PHLDB1 "Uncharacterized protei 0.986 0.105 0.586 7.4e-44
UNIPROTKB|E9PGF6744 PHLDB2 "Uncharacterized protei 0.986 0.193 0.565 7.9e-44
UNIPROTKB|E2RMC81490 PHLDB1 "Uncharacterized protei 0.986 0.096 0.586 8.7e-44
UNIPROTKB|E9PKC1 PHLDB1 "Pleckstrin homology-like domain family B member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 475 (172.3 bits), Expect = 3.4e-45, P = 3.4e-45
 Identities = 85/145 (58%), Positives = 108/145 (74%)

Query:     1 RPLTRYLPFRGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGRFHHWNKRWFV 60
             RPLTRYLP R +  DL+ HIE++GH ++ C H+ L +  CRGYL KM G+   W KRWFV
Sbjct:   271 RPLTRYLPIRKEDFDLKTHIESSGHGVDTCLHVVLSSKVCRGYLVKMGGKIKSWKKRWFV 330

Query:    61 FDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSV-KSPSPHLTFVVKSSDRTFHL 119
             FDR  R+L+YY D+ E K +G  YF+ IEEVY DHL S  KSP+P LTF VK+ DR +++
Sbjct:   331 FDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLRSAAKSPNPALTFCVKTHDRLYYM 390

Query:   120 MAPSAEAMRIWIDVIFSGAEGYQEF 144
             +APSAEAMRIW+DVI +GAEGY +F
Sbjct:   391 VAPSAEAMRIWMDVIVTGAEGYTQF 415




GO:0005543 "phospholipid binding" evidence=IEA
UNIPROTKB|E9PMZ5 PHLDB1 "Pleckstrin homology-like domain family B member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091118-9 si:ch211-244c8.3 "si:ch211-244c8.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D4A5C1 LOC360713 "Protein LOC360713" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQQ9 Phldb1 "Pleckstrin homology-like domain family B member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3235 si:dkey-11p10.8 "si:dkey-11p10.8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|620878 Phldb1 "pleckstrin homology-like domain, family B, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3N336 PHLDB1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PGF6 PHLDB2 "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMC8 PHLDB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q86UU1PHLB1_HUMANNo assigned EC number0.53840.98630.1045yesN/A
Q63312PHLB1_RATNo assigned EC number0.58620.98630.1732yesN/A
Q8K1N2PHLB2_MOUSENo assigned EC number0.57240.98630.1152yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
cd01235106 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als 4e-35
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 6e-14
smart00233102 smart00233, PH, Pleckstrin homology domain 1e-10
cd01265101 cd01265, PH_TBC1D2A, TBC1 domain family member 2A 4e-09
cd13324103 cd13324, PH_Gab-like, Grb2-associated binding prot 9e-09
cd13255110 cd13255, PH_TAAP2-like, Tandem PH-domain-containin 1e-08
pfam00169101 pfam00169, PH, PH domain 1e-08
cd13298106 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin 1e-08
cd1057396 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin 2e-08
cd13385125 cd13385, PH_Gab3, Grb2-associated binding protein 4e-08
cd13384115 cd13384, PH_Gab2_2, Grb2-associated binding protei 1e-07
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 3e-07
cd13263114 cd13263, PH_RhoGap25-like, Rho GTPase activating p 3e-06
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 3e-06
cd13273110 cd13273, PH_SWAP-70, Switch-associated protein-70 4e-06
cd01266123 cd01266, PH_Gab1_Gab2, Grb2-associated binding pro 5e-06
cd13291107 cd13291, PH_ORP10_ORP11, Human Oxysterol binding p 5e-06
cd13379114 cd13379, PH_RhoGap24, Rho GTPase activating protei 2e-05
cd13290102 cd13290, PH_ORP9, Human Oxysterol binding protein 2e-05
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 4e-05
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 6e-05
cd1325393 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, anky 8e-05
cd01238140 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstr 1e-04
cd13270118 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing 2e-04
cd13215130 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 4e-04
cd01251105 cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple 4e-04
cd13296111 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P 4e-04
cd01252118 cd01252, PH_GRP1-like, General Receptor for Phosph 0.002
cd13288120 cd13288, PH_Ses, Sesquipedalian family Pleckstrin 0.002
cd13378116 cd13378, PH_RhoGAP2, Rho GTPase activating protein 0.002
cd13297123 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin h 0.003
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain Back     alignment and domain information
 Score =  117 bits (295), Expect = 4e-35
 Identities = 39/103 (37%), Positives = 55/103 (53%), Gaps = 2/103 (1%)

Query: 39  SCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHL-- 96
           +C GYL K       W +RWFV D T   L YY  + + K +G    + +E VY D    
Sbjct: 4   TCEGYLYKRGALLKGWKQRWFVLDLTKHQLRYYESKEDTKCKGVIDLQEVESVYPDTPSI 63

Query: 97  NSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVIFSGAE 139
            + KSP P   F +K++ R ++ +APSAEA + WIDVI +   
Sbjct: 64  GAPKSPDPGAFFELKTNKRVYYFLAPSAEAAQQWIDVIQTLLS 106


Sbf1 is a myotubularin-related pseudo-phosphatase. Both Sbf1 and myotubularin interact with the SET domains of Hrx and other epigenetic regulatory proteins, but Sbf1 lacks phosphatase activity due to several amino acid changes in its structurally preserved catalytic pocket. It contains pleckstrin (PH), GEF, and myotubularin homology domains that are thought to be responsible for signaling and growth control. Sbf1 functions as an inhibitor of cellular growth. The N-terminal GEF homology domain serves to inhibit the transforming effects of Sbf1. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 106

>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241478 cd13324, PH_Gab-like, Grb2-associated binding protein family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241536 cd13385, PH_Gab3, Grb2-associated binding protein 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241535 cd13384, PH_Gab2_2, Grb2-associated binding protein family pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241297 cd01266, PH_Gab1_Gab2, Grb2-associated binding proteins 1 and 2 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241445 cd13291, PH_ORP10_ORP11, Human Oxysterol binding protein (OSBP) related proteins 10 and 11 (ORP10 and ORP11) Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241444 cd13290, PH_ORP9, Human Oxysterol binding protein related protein 9 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241424 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, N-terminal repeat Back     alignment and domain information
>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH) domain, repeat 3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.94
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.94
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.93
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.92
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.92
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.92
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.91
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.91
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.9
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.9
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.89
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.89
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.87
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.86
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.86
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.86
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.83
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.81
PF1540989 PH_8: Pleckstrin homology domain 99.79
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.77
KOG0930|consensus395 99.76
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.75
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.72
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.71
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.71
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.69
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.68
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 99.67
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 99.62
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.59
KOG1090|consensus1732 99.59
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 99.56
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 99.55
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 99.52
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 99.46
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 99.46
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 99.34
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 99.23
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 99.16
KOG0690|consensus 516 99.16
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 99.14
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 99.11
KOG2059|consensus 800 99.09
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 99.08
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 99.04
KOG3640|consensus1116 99.03
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 99.0
KOG3751|consensus 622 98.92
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 98.87
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 98.8
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 98.73
PTZ00267478 NIMA-related protein kinase; Provisional 98.68
KOG1117|consensus 1186 98.64
KOG0521|consensus 785 98.58
KOG0248|consensus 936 98.48
PLN02866 1068 phospholipase D 98.47
KOG0932|consensus 774 98.47
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 98.46
KOG1739|consensus 611 98.42
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 98.4
KOG1117|consensus 1186 98.35
KOG3531|consensus1036 98.32
KOG3723|consensus851 98.26
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 98.24
PTZ00283496 serine/threonine protein kinase; Provisional 98.22
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 98.19
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 98.15
KOG4424|consensus 623 98.14
PF15406112 PH_6: Pleckstrin homology domain 98.03
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 97.98
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 97.95
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 97.82
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 97.6
KOG1451|consensus 812 97.53
KOG3543|consensus 1218 97.46
PF15408104 PH_7: Pleckstrin homology domain 97.44
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 97.3
KOG4236|consensus 888 97.27
PF15404185 PH_4: Pleckstrin homology domain 97.07
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 97.03
KOG1737|consensus 799 96.74
KOG0592|consensus604 96.72
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 96.72
KOG3551|consensus506 96.65
KOG3549|consensus 505 96.41
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 96.17
PF15411116 PH_10: Pleckstrin homology domain 96.03
KOG4424|consensus623 95.49
KOG4807|consensus 593 95.29
KOG1738|consensus638 95.24
cd01255160 PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM 95.08
KOG4047|consensus 429 93.97
KOG0248|consensus 936 93.89
KOG0705|consensus 749 93.77
KOG1264|consensus 1267 92.81
KOG3523|consensus695 92.38
PF08458110 PH_2: Plant pleckstrin homology-like region; Inter 91.36
KOG3727|consensus 664 91.21
KOG4407|consensus 1973 87.02
KOG3551|consensus 506 86.9
cd05394313 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the 83.54
KOG2070|consensus 661 82.76
cd05128315 RasGAP_GAP1_like The GAP1 family of Ras GTPase-act 82.56
PF1527791 Sec3-PIP2_bind: Exocyst complex component SEC3 N-t 80.91
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
Probab=99.94  E-value=1.3e-25  Score=145.84  Aligned_cols=98  Identities=20%  Similarity=0.267  Sum_probs=82.0

Q ss_pred             ceEEEEEEeecCCCCCceeeEEEEEcCCCEEEEEeCCCCccccceEEcccceEEEecCCCCCCCCCCCeEEEEEeCCeEE
Q psy17150         38 TSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTF  117 (146)
Q Consensus        38 ~~~~G~L~k~~~~~~~Wk~r~fvL~~~~~~L~yy~~~~~~~~~g~i~L~~~~~v~~~~~~~~~~~~~~~~f~i~t~~r~~  117 (146)
                      ++++|||.|+++..+.|++|||||+  ++.|+||+++.+..+.|.|+|..+.......  ..+..++.++|.|.+++++|
T Consensus         2 v~k~G~L~Kkg~~~k~WkkRwfvL~--~~~L~yyk~~~~~~~~~~I~L~~~~v~~~~~--~~~~~~~~~~F~I~t~~rt~   77 (100)
T cd01233           2 VSKKGYLNFPEETNSGWTRRFVVVR--RPYLHIYRSDKDPVERGVINLSTARVEHSED--QAAMVKGPNTFAVCTKHRGY   77 (100)
T ss_pred             cceeEEEEeeCCCCCCcEEEEEEEE--CCEEEEEccCCCccEeeEEEecccEEEEccc--hhhhcCCCcEEEEECCCCEE
Confidence            4599999999998899999999999  8999999999999999999999654332211  11122346899999999999


Q ss_pred             EEECCCHHHHHHHHHHHHHhhh
Q psy17150        118 HLMAPSAEAMRIWIDVIFSGAE  139 (146)
Q Consensus       118 ~l~a~s~~e~~~Wi~al~~~~~  139 (146)
                      +|+|+|++|+++||++|+.+..
T Consensus        78 ~~~A~s~~e~~~Wi~ai~~~~~   99 (100)
T cd01233          78 LFQALSDKEMIDWLYALNPLYA   99 (100)
T ss_pred             EEEcCCHHHHHHHHHHhhhhhc
Confidence            9999999999999999987654



Unc-104 pleckstrin homology (PH) domain. Unc-104 is a kinesin-like protein containing an N-terminal kinesin catalytic domain, followed by a forkhead associated domain with a C-terminal PH domain. These proteins are responsible for the transport of membrane vesicles along microtubules. The mechanism involves the binding of the PH domain to phosphatidiylinositol (4,5) P2-containing liposomes.

>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0930|consensus Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1090|consensus Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3640|consensus Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>KOG0932|consensus Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1739|consensus Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG3723|consensus Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG3543|consensus Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>KOG1737|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15411 PH_10: Pleckstrin homology domain Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>KOG4807|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4047|consensus Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function Back     alignment and domain information
>KOG3727|consensus Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd05394 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the GAP1 family of Ras GTPase-activating proteins that includes GAP1_IP4BP (or RASA3), CAPRI, and RASAL Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>cd05128 RasGAP_GAP1_like The GAP1 family of Ras GTPase-activating proteins includes GAP1(m) (or RASA2), GAP1_IP4BP (or RASA3), Ca2+ -promoted Ras inactivator (CAPRI, or RASAL4), and Ras GTPase activating-like proteins (RASAL) or RASAL1 Back     alignment and domain information
>PF15277 Sec3-PIP2_bind: Exocyst complex component SEC3 N-terminal PIP2 binding PH; PDB: 3HIE_D 3A58_E Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
3tfm_A228 Myosin X Ph1n-Ph2-Ph1c Tandem Length = 228 4e-06
1v5u_A117 Solution Structure Of The C-Terminal Pleckstrin Hom 1e-05
2dn6_A115 Solution Structure Of The Ph Domain Of Kiaa0640 Pro 3e-04
>pdb|3TFM|A Chain A, Myosin X Ph1n-Ph2-Ph1c Tandem Length = 228 Back     alignment and structure

Iteration: 1

Score = 47.0 bits (110), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 9/82 (10%) Query: 53 HWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKS 112 +W KRWFV R S+ L Y+ + SE+K +G R +E+ +D+ N + Sbjct: 78 NWKKRWFVL-RQSK-LMYFENDSEEKLKGTVEVRSAKEI-IDNTNKENG------IDIIM 128 Query: 113 SDRTFHLMAPSAEAMRIWIDVI 134 +DRTFHL+A S E W V+ Sbjct: 129 ADRTFHLIAESPEDASQWFSVL 150
>pdb|1V5U|A Chain A, Solution Structure Of The C-Terminal Pleckstrin Homology Domain Of Sbf1 From Mouse Length = 117 Back     alignment and structure
>pdb|2DN6|A Chain A, Solution Structure Of The Ph Domain Of Kiaa0640 Protein From Human Length = 115 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 3e-34
1v5p_A126 Pleckstrin homology domain-containing, family A; T 2e-25
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 9e-25
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 3e-24
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 3e-23
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 6e-23
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 3e-22
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 2e-21
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 1e-20
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 7e-19
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 1e-18
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 2e-18
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 2e-18
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 4e-18
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 6e-18
3aj4_A112 Pleckstrin homology domain-containing family B ME; 7e-18
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 3e-17
2d9v_A130 Pleckstrin homology domain-containing protein fami 3e-16
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 8e-16
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 9e-16
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 1e-15
2d9y_A117 Pleckstrin homology domain-containing protein fami 1e-15
2yry_A122 Pleckstrin homology domain-containing family A mem 1e-15
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 7e-15
1u5e_A211 SRC-associated adaptor protein; novel dimerization 8e-15
2dkp_A128 Pleckstrin homology domain-containing family A mem 1e-14
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 1e-14
3rcp_A103 Pleckstrin homology domain-containing family A ME; 3e-13
3cxb_B112 Pleckstrin homology domain-containing family M mem 7e-13
1wi1_A126 Calcium-dependent activator protein for secretion, 5e-12
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 6e-12
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 1e-11
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 1e-11
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 2e-11
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 4e-11
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 2e-10
1qqg_A 264 IRS-1, insulin receptor substrate 1; beta-sandwhic 8e-10
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 1e-09
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 2e-09
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 3e-09
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 5e-09
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 6e-09
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 1e-08
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 7e-08
1v88_A130 Oxysterol binding protein-related protein 8; vesic 1e-07
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 4e-07
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 1e-06
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 1e-06
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 3e-06
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 3e-06
2d9w_A127 Docking protein 2; PH domain, structural genomics, 4e-06
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 5e-06
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 5e-06
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 3e-05
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 4e-05
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 9e-05
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 9e-05
3a8n_A 279 TIAM-1, T-lymphoma invasion and metastasis-inducin 1e-04
3ml4_A 224 Protein DOK-7; tyrosine phosphorylation, adapter p 3e-04
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
 Score =  114 bits (288), Expect = 3e-34
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 2/98 (2%)

Query: 39  SCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDH--L 96
           S  G L K       W  RWFV D+T   L YY  R + + +G      +E V      +
Sbjct: 9   SYEGILYKKGAFMKPWKARWFVLDKTKHQLRYYDHRMDTECKGVIDLAEVEAVAPGTPTI 68

Query: 97  NSVKSPSPHLTFVVKSSDRTFHLMAPSAEAMRIWIDVI 134
            + K+      F VK++ R ++  A    + + W+D I
Sbjct: 69  GAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDRI 106


>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Length = 256 Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Length = 151 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Length = 224 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.94
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.93
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.93
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.93
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.93
1wi1_A126 Calcium-dependent activator protein for secretion, 99.93
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.92
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.92
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.92
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.92
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.92
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.92
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.92
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.92
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.92
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.92
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.92
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.92
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.92
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.92
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.92
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.92
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.91
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.91
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.91
2yry_A122 Pleckstrin homology domain-containing family A mem 99.91
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.91
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.91
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.91
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.91
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.91
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.9
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.9
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.9
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.9
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.89
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.89
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.89
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.88
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.88
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.88
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.88
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.87
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.87
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.87
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.87
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.87
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.86
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.85
1qqg_A 264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.85
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 99.84
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.83
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 99.83
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 99.82
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.82
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.82
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.81
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 99.8
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.79
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.78
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 99.75
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.73
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.73
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.7
3a8n_A 279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.64
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 99.64
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.62
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 99.6
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 99.59
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 99.57
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 99.56
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 99.2
3ml4_A 224 Protein DOK-7; tyrosine phosphorylation, adapter p 98.97
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 98.77
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 98.69
3tfm_A 228 Myosin X; split PH domain, motor protein; 2.53A {R 98.6
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 98.57
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 98.22
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 98.17
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 98.16
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 98.13
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 98.12
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.01
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 97.98
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 97.98
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.95
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 97.93
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 97.9
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 97.83
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 97.8
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 97.77
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 97.76
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 97.75
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 97.73
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 97.68
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 97.65
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 97.64
1foe_A377 T-lymphoma invasion and metastasis inducing protei 97.47
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 97.43
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 96.89
2adz_A178 Alpha-1-syntrophin; protein binding; NMR {Mus musc 96.77
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 96.71
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 96.54
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 96.32
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 95.95
3a98_B203 Engulfment and cell motility protein 1; protein-pr 94.49
3hie_A171 Protein PSL1, exocyst complex component SEC3; PH d 90.12
3a58_A320 Exocyst complex component SEC3; protein complex, P 87.33
3ulb_A121 Target of rapamycin complex 2 subunit AVO1; PH dom 86.58
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
Probab=99.94  E-value=4.9e-26  Score=156.49  Aligned_cols=105  Identities=12%  Similarity=0.184  Sum_probs=88.1

Q ss_pred             cCCCCCCCCceEEEEEEeecCCCCCceeeEEEEEcCCCEEEEEeCCCCccccceEEcccceEEEecCCCCCCCCCCCeEE
Q psy17150         29 ACSHLTLDATSCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTF  108 (146)
Q Consensus        29 ~~~~~~~~~~~~~G~L~k~~~~~~~Wk~r~fvL~~~~~~L~yy~~~~~~~~~g~i~L~~~~~v~~~~~~~~~~~~~~~~f  108 (146)
                      ........+++++|||.|+|+..+.|++|||||+  ++.|+||+++.+..+.|.|+|..+..+......    ..+.++|
T Consensus         9 ~~~~~~~~pv~keG~L~Kkg~~~k~WkrRWFvLk--~~~L~Yyk~~~d~~~~g~I~L~~~~~~~~~~~~----~~~~~~F   82 (149)
T 1x1f_A            9 ERLKITALPLYFEGFLLIKRSGYREYEHYWTELR--GTTLFFYTDKKSIIYVDKLDIVDLTCLTEQNST----EKNCAKF   82 (149)
T ss_dssp             CCCSCSSSCEEEEEEEEEECTTCCSCEEEEEEEE--TTEEEEESCSSCSSCSEECCCSSCCEEEECCCT----TSCCCEE
T ss_pred             hcccCCCCCccEEEEEEEeCCCCCCceeEEEEEc--CCEEEEEeCCCccccCcEEECCCceEEeeccCC----CCcCcEE
Confidence            3444445557799999999998899999999999  899999999999999999999998765332111    1235899


Q ss_pred             EEEeCCeEEEEECCCHHHHHHHHHHHHHhhh
Q psy17150        109 VVKSSDRTFHLMAPSAEAMRIWIDVIFSGAE  139 (146)
Q Consensus       109 ~i~t~~r~~~l~a~s~~e~~~Wi~al~~~~~  139 (146)
                      .|.+++++|+|+|+|.+|+++||++|++++.
T Consensus        83 ~I~t~~r~~~f~A~s~ee~~eWi~aI~~v~~  113 (149)
T 1x1f_A           83 TLVLPKEEVQLKTENTESGEEWRGFILTVTE  113 (149)
T ss_dssp             EEECSSCCEEEECSSHHHHHHHHHHHHHHHH
T ss_pred             EEEcCCCEEEEEcCCHHHHHHHHHHHHHHHc
Confidence            9999999999999999999999999998865



>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>3a98_B Engulfment and cell motility protein 1; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} PDB: 2vsz_A Back     alignment and structure
>3hie_A Protein PSL1, exocyst complex component SEC3; PH domain, dimer, domain swapping, phosphate-binding, coiled coil, exocytosis; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ulb_A Target of rapamycin complex 2 subunit AVO1; PH domain, membrane localization, membrane protein; 1.90A {Saccharomyces cerevisiae} PDB: 3ulc_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 146
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 5e-17
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 1e-15
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 3e-14
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3e-14
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 4e-14
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 1e-13
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 2e-13
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 3e-12
d1qqga1103 b.55.1.2 (A:12-114) Insulin receptor substrate 1, 4e-12
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 5e-12
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 3e-11
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 4e-11
d2coca199 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont 1e-10
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 5e-10
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 6e-10
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 6e-10
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 8e-10
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 3e-09
d1maia_119 b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus 1e-08
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 2e-08
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 2e-08
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 5e-08
d1x1fa1136 b.55.1.1 (A:8-143) Signal-transducing adaptor prot 6e-08
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 1e-07
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 1e-07
d1w1ha_147 b.55.1.1 (A:) 3-phosphoinositide dependent protein 2e-07
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 3e-07
d2cofa195 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) 4e-07
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 5e-07
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 2e-06
d2coaa1112 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma 5e-06
d1omwa2119 b.55.1.1 (A:550-668) G-protein coupled receptor ki 8e-06
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 9e-06
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 3e-05
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 4e-05
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 2e-04
d1ki1b2142 b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( 0.003
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Src-associated adaptor protein Skap2
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 71.9 bits (175), Expect = 5e-17
 Identities = 23/129 (17%), Positives = 38/129 (29%), Gaps = 7/129 (5%)

Query: 10  RGDSLDLRQHIEAAGHQLEACSHLTLDATSCRGYLNKMAGR----FHHWNKRWFVFDRTS 65
             +  D      + G+Q    +   L      GYL K           W KRW    +T 
Sbjct: 76  ASERYDKDDDGPSDGNQFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTV 135

Query: 66  RSLAYYSDRSEKKQRGATYFRCIEEVYVDHLNSVKSPSPHLTFVVKSSDRTFHLMAPSAE 125
               YY    +K+Q+G       +    + L            +     R +   A S +
Sbjct: 136 --FYYYGSDKDKQQKGEFAIDGYDVRMNNTLRK-DGKKDCCFEICAPDKRIYQFTAASPK 192

Query: 126 AMRIWIDVI 134
               W+  +
Sbjct: 193 DAEEWVQQL 201


>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 119 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.93
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.93
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.92
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.91
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.91
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.91
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.91
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.9
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.9
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.9
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.9
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.89
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.89
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.89
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.89
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.89
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.89
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.88
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.88
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.87
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.87
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.87
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.87
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.86
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.86
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.85
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.85
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.85
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.79
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.79
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.78
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 99.37
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 99.28
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 99.25
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 99.14
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.81
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 98.8
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 98.44
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 98.41
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 98.34
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 98.2
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 98.13
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 98.0
d2zkmx3131 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.83
d1foea2162 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 95.3
d1zsqa1125 Myotubularin-related protein 2, N-terminal domain 90.16
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Protein kinase c, d2 type
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=6e-26  Score=147.45  Aligned_cols=98  Identities=13%  Similarity=0.211  Sum_probs=84.2

Q ss_pred             eEEEEEEeecCCCCCceeeEEEEEcCCCEEEEEeCCCCccccceEEcccceEEEecCC-CCCCCCCCCeEEEEEeCCeEE
Q psy17150         39 SCRGYLNKMAGRFHHWNKRWFVFDRTSRSLAYYSDRSEKKQRGATYFRCIEEVYVDHL-NSVKSPSPHLTFVVKSSDRTF  117 (146)
Q Consensus        39 ~~~G~L~k~~~~~~~Wk~r~fvL~~~~~~L~yy~~~~~~~~~g~i~L~~~~~v~~~~~-~~~~~~~~~~~f~i~t~~r~~  117 (146)
                      +++|||.|+++..+.|++|||||+  ++.|+||+++.+..|+|.|+|..+..+..... .........++|+|.|++++|
T Consensus         2 lk~GwL~k~~~~~~~wkkRwFvL~--~~~L~YYk~~~~~~p~g~I~L~~~~~v~~~~~~~~~~~~~~~~~F~I~T~~rty   79 (112)
T d2coaa1           2 LREGWVVHYSNKDTLRKRHYWRLD--CKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATY   79 (112)
T ss_dssp             SEEEEEEECCSSSCCCEEEEEEEC--SSEEEEESSSSCSSCSEEEETTTCCEEEESCCCSSSCTTSCCEEEEEECSSCCC
T ss_pred             ceEEEEEEECCCCCCeeEEEEEEE--cceEEEEeccCCCccceEEeeeccccccccccccccccCCCccEEEEEeCCeEE
Confidence            499999999998899999999999  89999999999999999999999888775332 222333456999999999999


Q ss_pred             EEEC-----------CCHHHHHHHHHHHHHhh
Q psy17150        118 HLMA-----------PSAEAMRIWIDVIFSGA  138 (146)
Q Consensus       118 ~l~a-----------~s~~e~~~Wi~al~~~~  138 (146)
                      ||.+           ++++++++|+++|++|.
T Consensus        80 y~~~~~~~~~~~~s~~~~~~~~~W~~aI~~A~  111 (112)
T d2coaa1          80 FVGEMPGGTPGGPSGQGAEAARGWETAIRQAL  111 (112)
T ss_dssp             CEECCSCCCSSSCCCCCSHHHHHHHHHHHHHG
T ss_pred             EEecCCccccccccccChHHHHHHHHHHHHhh
Confidence            9966           67888999999999975



>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zsqa1 b.55.1.8 (A:74-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure