Diaphorina citri psyllid: psy17162


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MRSIRAVFNQDEIGVTVSSVKTTDDKKVVLVTGKGEAEKVQKELETLRCIYIQDYHLCVRSTRYFSVDTFHQRLQFLLHLFRFALSGNQDDLLIIRGLYGADCDPNFIRPERIDPSGNPSNYDIRSDVWSLGISLIELATGRFPYDTWGSPFEQLKQVVQDDPPRLPPGEFSSDFKDFITLW
ccEECcEECcccEEEEEEEccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEccccccccHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccHHHHHcccccccccccccccccHHHHHHHHcc
MRSIRAVFNQDEIGVTVSSVKTTDDKKVVLVTGKGEAEKVQKELETLRCIYIQDYHLCVRSTRYFSVDTFHQRLQFLLHLFRFALSGNQDDLLIIRGLYGADCDPNFIRPERIDPSGNPSNYDIRSDVWSLGISLIELATGRFPYDTWGSPFEQLKQVVQDDPP*****EFSSDFKDFITLW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSIRAVFNQDEIGVTVSSVKTTDDKKVVLVTGKGEAEKVQKELETLRCIYIQDYHLCVRSTRYFSVDTFHQRLQFLLHLFRFALSGNQDDLLIIRGLYGADCDPNFIRPERIDPSGNPSNYDIRSDVWSLGISLIELATGRFPYDTWGSPFEQLKQVVQDDPPRLPPGEFSSDFKDFITLW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dual specificity mitogen-activated protein kinase kinase 6 Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases.confidentQ5E9X2
Dual specificity mitogen-activated protein kinase kinase 6 Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13 and MAPK14 and plays an important role in the regulation of cellular responses to cytokines and all kinds of stresses. Especially, MAP2K3/MKK3 and MAP2K6/MKK6 are both essential for the activation of MAPK11 and MAPK13 induced by environmental stress, whereas MAP2K6/MKK6 is the major MAPK11 activator in response to TNF. MAP2K6/MKK6 also phosphorylates and activates PAK6. The p38 MAP kinase signal transduction pathway leads to direct activation of transcription factors. Nuclear targets of p38 MAP kinase include the transcription factors ATF2 and ELK1. Within the p38 MAPK signal transduction pathway, MAP3K6/MKK6 mediates phosphorylation of STAT4 through MAPK14 activation, and is therefore required for STAT4 activation and STAT4-regulated gene expression in response to IL-12 stimulation. The pathway is also crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction; and for IFNG-dependent gene transcription. Has a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, and in endochondral ossification and since SOX9 is another likely downstream target of the p38 MAPK pathway. MAP2K6/MKK6 mediates apoptotic cell death in thymocytes. Acts also as a regulator for melanocytes dendricity, through the modulation of Rho family GTPases.confidentP52564

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050793 [BP]regulation of developmental processprobableGO:0008150, GO:0065007, GO:0050789
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0060048 [BP]cardiac muscle contractionprobableGO:0032501, GO:0044707, GO:0006936, GO:0008015, GO:0006941, GO:0003012, GO:0060047, GO:0008150, GO:0003015, GO:0003013, GO:0044699, GO:0003008
GO:0034142 [BP]toll-like receptor 4 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0033267 [CC]axon partprobableGO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0008545 [MF]JUN kinase kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0004712, GO:0004672, GO:0003674, GO:0004708
GO:0007257 [BP]activation of JUN kinase activityprobableGO:0000187, GO:0080135, GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0051246, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0051247, GO:0023056, GO:0043406, GO:0043405, GO:0051174, GO:0007165, GO:0046328, GO:0043506, GO:0071902, GO:0035556, GO:0071900, GO:0010627, GO:0010647, GO:0043085, GO:0043408, GO:0007254, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0000165, GO:0031098, GO:0050789, GO:0023051, GO:0060255, GO:0032268, GO:0032270, GO:0044699, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0042325, GO:0050790, GO:0045937, GO:0044700, GO:0070302, GO:0031323, GO:0045859, GO:0080090, GO:0051716, GO:0050794, GO:0032872, GO:0006950, GO:0051403, GO:0044763, GO:0023052, GO:0007154, GO:0043507, GO:0043410, GO:0042327, GO:0001932, GO:0007243, GO:0050896, GO:0031401, GO:0051338, GO:0080134, GO:0033554, GO:0008150, GO:0009987, GO:0045860, GO:0001934, GO:0048522
GO:0034138 [BP]toll-like receptor 3 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0034134 [BP]toll-like receptor 2 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0034130 [BP]toll-like receptor 1 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0035666 [BP]TRIF-dependent toll-like receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002756, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043204 [CC]perikaryonprobableGO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0031435 [MF]mitogen-activated protein kinase kinase kinase bindingprobableGO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0002755 [BP]MyD88-dependent toll-like receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0032839 [CC]dendrite cytoplasmprobableGO:0005737, GO:0032838, GO:0044463, GO:0044464, GO:0030425, GO:0005622, GO:0005575, GO:0097458, GO:0044444, GO:0005623, GO:0043005, GO:0044424, GO:0042995
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0008063 [BP]Toll signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0045087 [BP]innate immune responseprobableGO:0002376, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0006955

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X7F, chain A
Confidence level:very confident
Coverage over the Query: 4-87,102-181
View the alignment between query and template
View the model in PyMOL