Diaphorina citri psyllid: psy17172


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MEHFNLDVVRVWKLFSLIEEGYHGTNPYHNSIHATDIKRHLTHLEIMASLLAAVAHDLDHPGVNQPFLIATSNHLAALYE
cccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHccHHHHHHHHHHHHHHccccccccHHHHHHHccHHHHHcc
*EHFNLDVVRVWKLFSLIEEGYHGTNPYHNSIHATDIKRHLTHLEIMASLLAAVAHDLDHPGVNQPFLIATSNHLAALYE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHFNLDVVRVWKLFSLIEEGYHGTNPYHNSIHATDIKRHLTHLEIMASLLAAVAHDLDHPGVNQPFLIATSNHLAALYE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
cAMP-specific 3',5'-cyclic phosphodiesterase 7B Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain.confidentQ9QXQ1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048101 [MF]calcium- and calmodulin-regulated 3',5'-cyclic-GMP phosphodiesterase activityprobableGO:0016787, GO:0008081, GO:0047555, GO:0003824, GO:0016788, GO:0042578, GO:0004114, GO:0003674, GO:0004112
GO:0001556 [BP]oocyte maturationprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0010259, GO:0007276, GO:0000003, GO:0048869, GO:0044699, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0044763, GO:0022412, GO:0044767, GO:0044702, GO:0003006, GO:0048856, GO:0008150
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0071321 [BP]cellular response to cGMPprobableGO:0070887, GO:0014074, GO:0044699, GO:0009719, GO:0051716, GO:1901698, GO:0071417, GO:0071310, GO:0014070, GO:0046683, GO:0071495, GO:0009987, GO:0070305, GO:0044763, GO:0042221, GO:0010033, GO:1901700, GO:1901701, GO:0071407, GO:0010243, GO:1901699, GO:0008150, GO:0050896
GO:0006198 [BP]cAMP catabolic processprobableGO:0009187, GO:0009214, GO:0046434, GO:0009166, GO:0034641, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0009259, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0046483, GO:0046058, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0008152, GO:0034655, GO:0046700, GO:0009056, GO:0055086, GO:1901565, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0019693, GO:0006163, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0009987, GO:0006753, GO:0044281
GO:0046068 [BP]cGMP metabolic processprobableGO:0009187, GO:0034641, GO:0006807, GO:0019693, GO:0072521, GO:0009259, GO:1901360, GO:0006139, GO:0044710, GO:0071704, GO:0009987, GO:0006725, GO:0009150, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:0006163, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0040020 [BP]regulation of meiosisprobableGO:0051445, GO:0051726, GO:2000241, GO:0010564, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030552 [MF]cAMP bindingprobableGO:0043168, GO:0030551, GO:0030554, GO:0097159, GO:0003674, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032555, GO:0017076, GO:0000166, GO:1901363, GO:1901265, GO:0005488
GO:0004115 [MF]3',5'-cyclic-AMP phosphodiesterase activityprobableGO:0016787, GO:0008081, GO:0004114, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004112
GO:0004117 [MF]calmodulin-dependent cyclic-nucleotide phosphodiesterase activityprobableGO:0016787, GO:0008081, GO:0004114, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004112
GO:0019933 [BP]cAMP-mediated signalingprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0019935, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SO2, chain A
Confidence level:very confident
Coverage over the Query: 2-80
View the alignment between query and template
View the model in PyMOL