Diaphorina citri psyllid: psy17184

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22

MSLQRQVAAKIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVFLRDFSEEQLQAGKTIIGLQAGSNKGATQAGQNIGAGRKIILGK

cccHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccHHHHccccccccHHHHccccccHHHcccHHHHHHHHHHHHHHHcccccccccHHHHcccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHccccccccccccccccccccccccccccccccc

************************AWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKP******R**EQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVFLRDFSEEQLQAGKTIIGLQ*****************RKII***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Muscle-specific protein 20		confident	P14318
Transgelin	Has actin-binding and actin-bundling activity. Stabilizes actin filaments against disassembly.	confident	Q08873

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008360 [BP]	regulation of cell shape	probable	GO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0007520 [BP]	myoblast fusion	probable	GO:0030154, GO:0061061, GO:0014706, GO:0000768, GO:0006949, GO:0009653, GO:0007275, GO:0044699, GO:0007517, GO:0051146, GO:0007519, GO:0048513, GO:0048869, GO:0035914, GO:0048646, GO:0032502, GO:0032501, GO:0014902, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0070594 [MF]	juvenile hormone response element binding	probable	GO:0044212, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0051015 [MF]	actin filament binding	probable	GO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044430 [CC]	cytoskeletal part	probable	GO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0005938 [CC]	cell cortex	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0007155 [BP]	cell adhesion	probable	GO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699
GO:0007015 [BP]	actin filament organization	probable	GO:0006996, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WYP, chain A
Confidence level:very confident
Coverage over the Query: 2-61,114-178
View the alignment between query and template
View the model in PyMOL

Template: 2RR8, chain A
Confidence level:very confident
Coverage over the Query: 1-69,114-202
View the alignment between query and template
View the model in PyMOL

Template: 1P2X, chain A
Confidence level:very confident
Coverage over the Query: 71-197
View the alignment between query and template
View the model in PyMOL