Psyllid ID: psy17184

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MSLQRQVAAKIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVFLRDFSEEQLQAGKTIIGLQAGSNKGATQAGQNIGAGRKIILGK
cccHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHcccccccHHHHccccccHHHcccHHHHHHHHHHHHHHHccccccccHHHHHcccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccEEHHEHcHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHccccccHEEEHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHccccEEEEEccccccccccccccccccEEEccc
MSLQRQVAAKIAAKRNPEQDKEAQAWIETVtgqkfpagvlyedaiKDGQILCHLINklkpgsiaakrnpeqdKEAQAWIETVtgqkfpagvlyedaiKDGQILCHLINklkpgsvakinssggqfkFMENINNFQKAIKDYgvadidvfqtvdlyekkdiaQVTNTIYALGREVFLRDFSEEQLQAGKTIIglqagsnkgatqagqnigagrkiilgk
MSLQRQVAAkiaakrnpeqdkeAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDlyekkdiaQVTNTIYALGREVFLRDFSEEQLQAGKTIiglqagsnkgatqagqnigagrkiilgk
MSLQRQVAAKIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVFLRDFSEEQLQAGKTIIGLQAGSNKGATQAGQNIGAGRKIILGK
************************AWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKP***************QAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVFLRDFSEEQLQAGKTIIGLQ************************
******************************************************************R**EQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVFLR**********************************RKII***
**********************AQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSIAA*********AQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVFLRDFSEEQLQAGKTIIGLQAGSNKGATQAGQNIGAGRKIILGK
*********K*********DKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVFLRDFSEEQLQAGKTIIGLQAGSNKGATQAGQNIGAGRK*IL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLQRQVAAKIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVFLRDFSEEQLQAGKTIIGLQAGSNKGATQAGQNIGAGRKIILGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
P14318184 Muscle-specific protein 2 yes N/A 0.715 0.847 0.695 4e-65
Q24799190 Myophilin OS=Echinococcus N/A N/A 0.701 0.805 0.476 3e-38
P26932 292 Calponin-1 OS=Gallus gall yes N/A 0.692 0.517 0.402 6e-26
Q08092 297 Calponin-1 OS=Sus scrofa yes N/A 0.692 0.508 0.408 6e-26
Q08290 297 Calponin-1 OS=Rattus norv yes N/A 0.692 0.508 0.402 1e-25
Q9GK38 297 Calponin-1 OS=Mustela put N/A N/A 0.692 0.508 0.402 1e-25
Q7YRL2 297 Calponin-1 OS=Ovis aries N/A N/A 0.692 0.508 0.402 2e-25
Q08091 297 Calponin-1 OS=Mus musculu yes N/A 0.692 0.508 0.402 2e-25
Q2HJ38 297 Calponin-1 OS=Bos taurus yes N/A 0.692 0.508 0.402 2e-25
Q32L92 329 Calponin-3 OS=Bos taurus no N/A 0.683 0.452 0.396 7e-25
>sp|P14318|MP20_DROME Muscle-specific protein 20 OS=Drosophila melanogaster GN=Mp20 PE=2 SV=2 Back     alignment and function desciption
 Score =  247 bits (631), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 121/174 (69%), Positives = 138/174 (79%), Gaps = 18/174 (10%)

Query: 63  IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSG 122
           IA+KRNPE DKEAQ WIE +  +KFPAG  YED +KDGQ+LC LIN L P +V K+NSSG
Sbjct: 11  IASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVNSSG 70

Query: 123 GQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVF------- 175
           GQFKFMENINNFQKA+K+YGV DIDVFQTVDLYEKKDIA VTNTI+ALGR  +       
Sbjct: 71  GQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKG 130

Query: 176 -----------LRDFSEEQLQAGKTIIGLQAGSNKGATQAGQNIGAGRKIILGK 218
                       RDF+EEQL+AG+TI+GLQAGSNKGATQAGQN+GAGRKI+LGK
Sbjct: 131 PFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGATQAGQNLGAGRKILLGK 184

Drosophila melanogaster (taxid: 7227)
>sp|Q24799|MYPH_ECHGR Myophilin OS=Echinococcus granulosus PE=2 SV=1 Back     alignment and function description
>sp|P26932|CNN1_CHICK Calponin-1 OS=Gallus gallus GN=CNN1 PE=1 SV=2 Back     alignment and function description
>sp|Q08092|CNN1_PIG Calponin-1 OS=Sus scrofa GN=CNN1 PE=2 SV=1 Back     alignment and function description
>sp|Q08290|CNN1_RAT Calponin-1 OS=Rattus norvegicus GN=Cnn1 PE=2 SV=1 Back     alignment and function description
>sp|Q9GK38|CNN1_MUSPF Calponin-1 OS=Mustela putorius furo GN=CNN1 PE=2 SV=1 Back     alignment and function description
>sp|Q7YRL2|CNN1_SHEEP Calponin-1 OS=Ovis aries GN=CNN1 PE=2 SV=1 Back     alignment and function description
>sp|Q08091|CNN1_MOUSE Calponin-1 OS=Mus musculus GN=Cnn1 PE=2 SV=1 Back     alignment and function description
>sp|Q2HJ38|CNN1_BOVIN Calponin-1 OS=Bos taurus GN=CNN1 PE=2 SV=1 Back     alignment and function description
>sp|Q32L92|CNN3_BOVIN Calponin-3 OS=Bos taurus GN=CNN3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
195379924184 GJ21167 [Drosophila virilis] gi|19414351 0.715 0.847 0.729 9e-67
195120406184 GI20073 [Drosophila mojavensis] gi|19390 0.715 0.847 0.718 6e-65
195028051184 GH21621 [Drosophila grimshawi] gi|193902 0.715 0.847 0.718 7e-65
242019570184 Muscle-specific protein, putative [Pedic 0.715 0.847 0.718 1e-64
90855695 384 IP13591p [Drosophila melanogaster] 0.715 0.406 0.706 3e-64
67527227184 muscle protein 20-like protein [Anoploph 0.715 0.847 0.701 1e-63
380020769184 PREDICTED: muscle-specific protein 20-li 0.715 0.847 0.683 1e-63
194883392184 GG20371 [Drosophila erecta] gi|190658972 0.715 0.847 0.701 1e-63
91081549184 PREDICTED: similar to muscle protein 20- 0.715 0.847 0.706 2e-63
17136346184 muscle protein 20 [Drosophila melanogast 0.715 0.847 0.695 2e-63
>gi|195379924|ref|XP_002048722.1| GJ21167 [Drosophila virilis] gi|194143519|gb|EDW59915.1| GJ21167 [Drosophila virilis] Back     alignment and taxonomy information
 Score =  258 bits (660), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 127/174 (72%), Positives = 144/174 (82%), Gaps = 18/174 (10%)

Query: 63  IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSG 122
           IA KRNPE DKEAQ WIE + G+KFPAG +YED +KDGQ+LC+LINKL+PG+VAKINSSG
Sbjct: 11  IAGKRNPEMDKEAQEWIEAILGEKFPAGQVYEDVLKDGQVLCNLINKLQPGAVAKINSSG 70

Query: 123 GQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVF------- 175
           GQFKFMEN+NNFQKA+K+YGV DIDVFQTVDLYEKKDIA VTNTI+ALGR  +       
Sbjct: 71  GQFKFMENLNNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHPEFKG 130

Query: 176 -----------LRDFSEEQLQAGKTIIGLQAGSNKGATQAGQNIGAGRKIILGK 218
                       RDFSEEQL+AG+TI+GLQAGSNKGATQAGQNIGAGRKI+LGK
Sbjct: 131 PFLGPKPADECKRDFSEEQLKAGQTIVGLQAGSNKGATQAGQNIGAGRKILLGK 184

Source: Drosophila virilis

Species: Drosophila virilis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195120406|ref|XP_002004718.1| GI20073 [Drosophila mojavensis] gi|193909786|gb|EDW08653.1| GI20073 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195028051|ref|XP_001986894.1| GH21621 [Drosophila grimshawi] gi|193902894|gb|EDW01761.1| GH21621 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|242019570|ref|XP_002430233.1| Muscle-specific protein, putative [Pediculus humanus corporis] gi|212515333|gb|EEB17495.1| Muscle-specific protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|90855695|gb|ABE01209.1| IP13591p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|67527227|gb|AAY68367.1| muscle protein 20-like protein [Anoplophora glabripennis] Back     alignment and taxonomy information
>gi|380020769|ref|XP_003694251.1| PREDICTED: muscle-specific protein 20-like [Apis florea] Back     alignment and taxonomy information
>gi|194883392|ref|XP_001975785.1| GG20371 [Drosophila erecta] gi|190658972|gb|EDV56185.1| GG20371 [Drosophila erecta] Back     alignment and taxonomy information
>gi|91081549|ref|XP_975000.1| PREDICTED: similar to muscle protein 20-like protein [Tribolium castaneum] gi|270005126|gb|EFA01574.1| hypothetical protein TcasGA2_TC007135 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|17136346|ref|NP_476643.1| muscle protein 20 [Drosophila melanogaster] gi|22096358|sp|P14318.2|MP20_DROME RecName: Full=Muscle-specific protein 20 gi|7303337|gb|AAF58396.1| muscle protein 20 [Drosophila melanogaster] gi|17946154|gb|AAL49118.1| RE55741p [Drosophila melanogaster] gi|220948976|gb|ACL87031.1| Mp20-PA [synthetic construct] gi|220957706|gb|ACL91396.1| Mp20-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
FB|FBgn0002789184 Mp20 "Muscle protein 20" [Dros 0.678 0.804 0.617 1.5e-44
FB|FBgn0038774169 CG5023 [Drosophila melanogaste 0.490 0.633 0.537 1.9e-33
ZFIN|ZDB-GENE-030131-5130 329 cnn3a "calponin 3, acidic a" [ 0.486 0.322 0.453 2.2e-27
ZFIN|ZDB-GENE-070912-1199 tagln "transgelin" [Danio reri 0.5 0.547 0.447 2.5e-26
ZFIN|ZDB-GENE-030131-542 307 cnn2 "calponin 2" [Danio rerio 0.486 0.345 0.444 1e-25
ZFIN|ZDB-GENE-020802-2201 tagln2 "transgelin 2" [Danio r 0.532 0.577 0.401 1.7e-25
ZFIN|ZDB-GENE-030131-4199199 tagln3b "transgelin 3b" [Danio 0.532 0.582 0.416 1.6e-17
UNIPROTKB|F1MHV8 288 CNN2 "Calponin-2" [Bos taurus 0.486 0.368 0.407 5.6e-25
UNIPROTKB|Q3SYU6 309 CNN2 "Calponin-2" [Bos taurus 0.486 0.343 0.407 5.6e-25
UNIPROTKB|Q99439 309 CNN2 "Calponin-2" [Homo sapien 0.486 0.343 0.407 7.1e-25
FB|FBgn0002789 Mp20 "Muscle protein 20" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 469 (170.2 bits), Expect = 1.5e-44, P = 1.5e-44
 Identities = 97/157 (61%), Positives = 112/157 (71%)

Query:    63 IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSG 122
             IA+KRNPE DKEAQ WIE +  +KFPAG  YED +KDGQ+LC LIN L P +V K+NSSG
Sbjct:    11 IASKRNPEMDKEAQEWIEAIIAEKFPAGQSYEDVLKDGQVLCKLINVLSPNAVPKVNSSG 70

Query:   123 GQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREVFLR-DFS- 180
             GQFKFMENINNFQKA+K+YGV DIDVFQTVDLYEKKDIA VTNTI+ALGR  +   DF  
Sbjct:    71 GQFKFMENINNFQKALKEYGVPDIDVFQTVDLYEKKDIANVTNTIFALGRATYKHADFKG 130

Query:   181 -------EEQLQAGKTIIGLQAGSNKGATQAGQNIGA 210
                     ++ +   T   L+AG      QAG N GA
Sbjct:   131 PFLGPKPADECKRDFTEEQLKAGQTIVGLQAGSNKGA 167
GO:0005509 "calcium ion binding" evidence=ISS
GO:0043292 "contractile fiber" evidence=NAS
GO:0003779 "actin binding" evidence=ISS
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0007155 "cell adhesion" evidence=IMP
GO:0007520 "myoblast fusion" evidence=IMP
FB|FBgn0038774 CG5023 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5130 cnn3a "calponin 3, acidic a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-1 tagln "transgelin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-542 cnn2 "calponin 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020802-2 tagln2 "transgelin 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4199 tagln3b "transgelin 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MHV8 CNN2 "Calponin-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SYU6 CNN2 "Calponin-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q99439 CNN2 "Calponin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q08873SCP1_YEASTNo assigned EC number0.30110.67880.74yesN/A
P14318MP20_DROMENo assigned EC number0.69540.71550.8478yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
COG5199178 COG5199, SCP1, Calponin [Cytoskeleton] 1e-26
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 7e-23
smart00033101 smart00033, CH, Calponin homology domain 2e-18
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 1e-14
COG5261 1054 COG5261, IQG1, Protein involved in regulation of c 9e-14
pfam0040226 pfam00402, Calponin, Calponin family repeat 0.003
>gnl|CDD|227526 COG5199, SCP1, Calponin [Cytoskeleton] Back     alignment and domain information 
 Score =  100 bits (251), Expect = 1e-26
 Identities = 54/168 (32%), Positives = 78/168 (46%), Gaps = 20/168 (11%)

Query: 65  AKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQ 124
                +Q KE   WIETV G+KF         +KDG  LC ++N+  P  + K   S   
Sbjct: 8   CPGMDKQQKEVTLWIETVLGEKFEPPGDLLSLLKDGVRLCRILNEASPLDI-KYKESKMP 66

Query: 125 FKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGREV---------F 175
           F  MENI++F   +K   V + ++FQT DL+E KD+ QV   +Y+L R           F
Sbjct: 67  FVQMENISSFINGLKKLRVPEYELFQTNDLFEAKDLRQVVICLYSLSRYAQKERMFSGPF 126

Query: 176 L---------RDFS-EEQLQAGKTIIGLQAGSNKGATQAGQNIGAGRK 213
           L         R FS +E L   K  I LQ G +  + Q+ +   +  +
Sbjct: 127 LGPHLATKKPRVFSSQEVLDRSKGAIHLQYGYSDLSEQSTEKGASNVR 174

Length = 178
>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information
>gnl|CDD|227586 COG5261, IQG1, Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|109460 pfam00402, Calponin, Calponin family repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
KOG2046|consensus193 100.0
COG5199178 SCP1 Calponin [Cytoskeleton] 100.0
cd00014107 CH Calponin homology domain; actin-binding domain 99.74
KOG2128|consensus 1401 99.73
COG5261 1054 IQG1 Protein involved in regulation of cellular mo 99.7
PF0040226 Calponin: Calponin family repeat; InterPro: IPR000 99.69
smart00033103 CH Calponin homology domain. Actin binding domains 99.6
KOG0532|consensus722 99.54
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 99.45
KOG2996|consensus 865 99.39
cd00014107 CH Calponin homology domain; actin-binding domain 99.08
KOG2128|consensus 1401 99.03
smart00033103 CH Calponin homology domain. Actin binding domains 98.9
COG5261 1054 IQG1 Protein involved in regulation of cellular mo 98.78
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 98.71
KOG0532|consensus722 98.58
KOG2046|consensus193 98.41
KOG0046|consensus 627 98.01
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 97.91
PF0639589 CDC24: CDC24 Calponin; InterPro: IPR010481 This is 97.8
COG5199178 SCP1 Calponin [Cytoskeleton] 97.54
KOG2996|consensus 865 97.48
KOG0046|consensus 627 96.88
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 93.75
PF0639589 CDC24: CDC24 Calponin; InterPro: IPR010481 This is 92.23
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 91.54
KOG0517|consensus 2473 90.95
>KOG2046|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-52  Score=336.89  Aligned_cols=165  Identities=52%  Similarity=0.778  Sum_probs=144.8

Q ss_pred             CChHHHHHHHHHccCChhHHHHHHHHHHHHhCCCCCCchhHHHHhhhhhHHHhhhhhccCCCccCCCChhhHHHHHHHHH
Q psy17184          1 MSLQRQVAAKIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSIAAKRNPEQDKEAQAWIE   80 (218)
Q Consensus         1 ~gl~~e~~~k~~~ky~~~~~~e~~~Wie~~~g~~i~~~~~~~~~LkdGvvLC~L~n~l~P~~i~kk~~~~~e~~i~~wie   80 (218)
                      +||++||++|+++|||+++|.|++.||+.++....+...+|++.||||++||+|+|+|+|                    
T Consensus         8 ~gl~~~v~~k~~~k~~~~~~~el~~WI~~~~~~~~~~~~~f~~~LKDG~iLCkl~N~l~p--------------------   67 (193)
T KOG2046|consen    8 YGLSREVQQKIESKYDDELEKELREWIENVVLTELPARGDFQDLLKDGVILCKLINKLYP--------------------   67 (193)
T ss_pred             cchHHHHHHHhhcccCHHHHHHHHHHHHHhhccCCCcccCHHHHHcchHHHHHHHHHhCc--------------------
Confidence            599999999999999999999999999998655544344566666666666665555554                    


Q ss_pred             HhhCCCCCCccchHHhhhchhHHHHHHHhhCCCCcccccCCCCccccchhHHHHHHHHHHhCCCccCccccchhccccCh
Q psy17184         81 TVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDI  160 (218)
Q Consensus        81 ~~l~~~l~~~d~f~~~l~dG~iLc~L~n~l~pg~i~ki~~~~~~f~~~eNI~~Fl~~~~~~Gv~~~~lF~~~DL~e~kn~  160 (218)
                                                      +.+++++.+.++|.++|||++|+.+|++|||+..++|+|+||||++|+
T Consensus        68 --------------------------------~~~~~~~~s~~~f~qmEnIs~Fi~a~~~ygv~~~d~FqtvDLfE~kd~  115 (193)
T KOG2046|consen   68 --------------------------------GVVKKINESKMAFVQMENISNFIKAAKKYGVPEVDLFQTVDLFEGKDM  115 (193)
T ss_pred             --------------------------------CcccccccccccHHHHHHHHHHHHHHHhcCCChhhcccccccccCCCH
Confidence                                            455566677889999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHhhhh------------------hcCCChhhhhcCCceeeeccccCCCCCcCCCC-CCCccccccC
Q psy17184        161 AQVTNTIYALGREVF------------------LRDFSEEQLQAGKTIIGLQAGSNKGATQAGQN-IGAGRKIILG  217 (218)
Q Consensus       161 ~qV~~~l~~L~r~~~------------------~r~f~~~~l~~~~~~i~lq~G~nk~asq~g~~-~g~~r~i~~~  217 (218)
                      .+|+.||++|++.+.                  +|+|++++|++++.+|||||||||||||+||+ ||++||++..
T Consensus       116 ~~V~vtL~aLa~~a~~~~~~~~~~~g~k~a~kq~r~f~~~~lk~g~~vi~LQmGtnk~asq~g~~~~G~~R~l~dp  191 (193)
T KOG2046|consen  116 AQVQVTLLALARKAQKKGLFSGPGIGPKLAEKQPREFTDEQLKAGQNVIGLQMGTNKGASQAGMTAYGTRRHLYDP  191 (193)
T ss_pred             HHHHHHHHHHHHHHhhccccCCCCcCCchhhcCcccCCHHHHhcccceEEEeeeccchhhcccccccccccccCCC
Confidence            999999999999997                  78999999999999999999999999999999 9999999864

>COG5199 SCP1 Calponin [Cytoskeleton] Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>KOG2128|consensus Back     alignment and domain information
>COG5261 IQG1 Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information
>PF00402 Calponin: Calponin family repeat; InterPro: IPR000557 Calponin [, ] is a thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>KOG2128|consensus Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>COG5261 IQG1 Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG2046|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>PF06395 CDC24: CDC24 Calponin; InterPro: IPR010481 This is a calponin homology domain Back     alignment and domain information
>COG5199 SCP1 Calponin [Cytoskeleton] Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>PF06395 CDC24: CDC24 Calponin; InterPro: IPR010481 This is a calponin homology domain Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0517|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
1wyp_A136 Solution Structure Of The Ch Domain Of Human Calpon 1e-20
1h67_A108 Nmr Structure Of The Ch Domain Of Calponin Length = 6e-20
1wyn_A146 Solution Structure Of The Ch Domain Of Human Calpon 7e-20
1wym_A155 Solution Structure Of The Ch Domain Of Human Transg 2e-14
1ujo_A144 Solution Structure Of The Ch Domain From Mouse Tran 5e-12
1p5s_A203 Structure And Function Of The Calponin-Homology Dom 9e-11
1p2x_A159 Crystal Structure Of The Calponin-Homology Domain O 1e-10
2rr8_A190 Solution Structure Of Calponin Homology Domain Of I 1e-07
3i6x_A193 Crystal Structure Of The Calponin Homology Domain O 1e-07
2d86_A143 Solution Structure Of The Ch Domain From Human Vav- 6e-06
1wyr_A121 Solution Structure Of The Ch Domain Of Human Rho Gu 1e-05
2l3g_A126 Solution Nmr Structure Of Ch Domain Of Rho Guanine 6e-04
>pdb|1WYP|A Chain A, Solution Structure Of The Ch Domain Of Human Calponin 1 Length = 136 Back     alignment and structure 
Iteration: 1

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 70/108 (64%), Gaps = 2/108 (1%)
Query: 63  IAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSG 122
           +A K + ++++E + WIE VTG++   G  + D +KDG ILC  INKL+PGSV KIN S 
Sbjct: 10  LAQKYDHQREQELREWIEGVTGRRI--GNNFMDGLKDGIILCEFINKLQPGSVKKINEST 67
Query: 123 GQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYAL 170
             +  +ENI NF KAI  YGV   D+F+  DL+E  +  QV +T+ AL
Sbjct: 68  QNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLAL 115
>pdb|1H67|A Chain A, Nmr Structure Of The Ch Domain Of Calponin Length = 108 Back     alignment and structure
>pdb|1WYN|A Chain A, Solution Structure Of The Ch Domain Of Human Calponin-2 Length = 146 Back     alignment and structure
>pdb|1WYM|A Chain A, Solution Structure Of The Ch Domain Of Human Transgelin-2 Length = 155 Back     alignment and structure
>pdb|1UJO|A Chain A, Solution Structure Of The Ch Domain From Mouse Trangelin Length = 144 Back     alignment and structure
>pdb|1P5S|A Chain A, Structure And Function Of The Calponin-Homology Domain Of An Iqgap Protein From Schizosaccharomyces Pombe Length = 203 Back     alignment and structure
>pdb|1P2X|A Chain A, Crystal Structure Of The Calponin-Homology Domain Of Rng2 From Schizosaccharomyces Pombe Length = 159 Back     alignment and structure
>pdb|2RR8|A Chain A, Solution Structure Of Calponin Homology Domain Of Iqgap1 Length = 190 Back     alignment and structure
>pdb|3I6X|A Chain A, Crystal Structure Of The Calponin Homology Domain Of Iqgap1 Length = 193 Back     alignment and structure
>pdb|2D86|A Chain A, Solution Structure Of The Ch Domain From Human Vav-3 Protein Length = 143 Back     alignment and structure
>pdb|1WYR|A Chain A, Solution Structure Of The Ch Domain Of Human Rho Guanine Nucleotide Exchange Factor 6 Length = 121 Back     alignment and structure
>pdb|2L3G|A Chain A, Solution Nmr Structure Of Ch Domain Of Rho Guanine Nucleotide Exchange Factor 7 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4495e Length = 126 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 4e-47
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 1e-46
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 3e-45
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 3e-44
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 3e-43
1ujo_A144 Transgelin; CH domain, actin binding, structural g 5e-43
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 3e-42
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 4e-42
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 2e-39
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 4e-39
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 9e-33
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 2e-12
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 2e-04
3hoc_A272 Filamin-A; calponin homology domain, actin binding 5e-04
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 5e-04
1pxy_A506 Fimbrin-like protein; calponin homology, F-actin-b 6e-04
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 6e-04
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Length = 108 Back     alignment and structure
 Score =  150 bits (380), Expect = 4e-47
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 69  PEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFM 128
           P+ +++ + WIE  TG++      + D +KDG ILC LINKL+PGSV K+N     +  +
Sbjct: 2   PQTERQLRVWIEGATGRRIGDN--FMDGLKDGVILCELINKLQPGSVQKVNDPVQNWHKL 59

Query: 129 ENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGR 172
           ENI NF +AIK YGV   D+F+  DL+E  +  QV +T+ AL  
Sbjct: 60  ENIGNFLRAIKHYGVKPHDIFEANDLFENTNHTQVQSTLIALAS 103
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 203 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 136 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 159 Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Length = 190 Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Length = 144 Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 146 Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Length = 193 Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A 2wfn_A Length = 272 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Length = 245 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 100.0
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 100.0
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 100.0
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 100.0
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 100.0
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 100.0
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 100.0
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 99.97
1ujo_A144 Transgelin; CH domain, actin binding, structural g 99.97
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 99.94
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 99.94
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 99.84
1ujo_A144 Transgelin; CH domain, actin binding, structural g 99.82
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 99.79
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 99.77
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 99.63
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 99.62
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 99.53
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 99.5
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 99.33
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 99.32
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 99.27
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 99.27
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.26
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.23
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 99.23
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 99.21
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.21
2qjz_A123 Microtubule-associated protein RP/EB family member 99.21
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 99.19
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 99.18
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 99.17
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 99.07
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.03
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 99.03
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 98.98
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 98.96
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 98.95
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 98.94
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 98.93
2qjz_A123 Microtubule-associated protein RP/EB family member 98.92
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 98.89
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 98.89
3hoc_A272 Filamin-A; calponin homology domain, actin binding 98.87
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 98.86
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 98.85
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 98.81
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 98.62
4b7l_A347 Filamin-B; structural protein, FR 1 filamin hinge 98.44
3hoc_A272 Filamin-A; calponin homology domain, actin binding 98.43
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 98.34
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 98.23
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 97.82
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 97.66
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 97.44
1wyl_A116 NEDD9 interacting protein with calponin homology a 97.41
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 97.36
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 97.2
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 97.06
1bhd_A118 Utrophin; calponin homology, actin binding, struct 97.01
2d88_A121 Protein mical-3; all alpha, calponin homology doma 96.96
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 96.54
2r8u_A 268 Microtubule-associated protein RP/EB family member 96.41
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 95.82
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 95.63
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 95.32
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 94.98
2r8u_A268 Microtubule-associated protein RP/EB family member 94.35
1wyl_A116 NEDD9 interacting protein with calponin homology a 94.34
2d88_A121 Protein mical-3; all alpha, calponin homology doma 94.32
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 94.24
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 92.89
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 92.66
1bhd_A118 Utrophin; calponin homology, actin binding, struct 92.63
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 91.36
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 91.27
2ee7_A127 Sperm flagellar protein 1; all alpha protein, CH d 81.56
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.5e-42  Score=281.65  Aligned_cols=157  Identities=22%  Similarity=0.385  Sum_probs=138.3

Q ss_pred             CChHHHHHHHHHccCChhHHHHHHHHHHHHhCCCCCCchhHHHHhhhhhHHHhhhhhccCCCcc--CCCChhhHHHHHHH
Q psy17184          1 MSLQRQVAAKIAAKRNPEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSIA--AKRNPEQDKEAQAW   78 (218)
Q Consensus         1 ~gl~~e~~~k~~~ky~~~~~~e~~~Wie~~~g~~i~~~~~~~~~LkdGvvLC~L~n~l~P~~i~--kk~~~~~e~~i~~w   78 (218)
                      .|||+++++|++++|+++. +|++.||+.++|+++|++++|+++|||||+||+|+|+++|++|+  +++++         
T Consensus         9 ~~md~~~~~k~a~~y~~~~-~e~~~WIe~~lg~~lp~~~~f~~~LrDGvvLCkL~N~l~P~sv~~~kI~~~---------   78 (190)
T 2rr8_A            9 EEMDERRRQNVAYEYLCHL-EEAKRWMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDR---------   78 (190)
T ss_dssp             CCSSSSCSCHHHHHHHHHH-HHHHHHHHHHSCCCCCCHHHHHHHHSSHHHHHHHHHHSCTTTSCSSCSSTT---------
T ss_pred             hhhhHHHHHHHHHhhcHHH-HHHHHHHHHHhCCCCCChhHHHHHHcchhhHHHHHHHhCCCCccccccccc---------
Confidence            4899999999999999988 89999999999999987678999999999999999999999873  33221         


Q ss_pred             HHHhhCCCCCCccchHHhhhchhHHHHHHHhhCCCCcccccCCCCccccchhHHHHHHHHHHhCCCccCccccchhcccc
Q psy17184         79 IETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDVFQTVDLYEKK  158 (218)
Q Consensus        79 ie~~l~~~l~~~d~f~~~l~dG~iLc~L~n~l~pg~i~ki~~~~~~f~~~eNI~~Fl~~~~~~Gv~~~~lF~~~DL~e~k  158 (218)
                                                         ...+++.++++|+++|||++||++|+++|||+.++|+|.||||++
T Consensus        79 -----------------------------------~~~~~~~~~~~f~~~eNI~~FL~ac~~~Gvp~~~lFet~DL~e~k  123 (190)
T 2rr8_A           79 -----------------------------------EQTRYKATGLHFRHTDNVIQWLNAMDEIGLPKIFYPETTDIYDRK  123 (190)
T ss_dssp             -----------------------------------TCHHHHHTCCCSSTHHHHHHHHHGGGGTTCCSTTCCCHHHHTCTT
T ss_pred             -----------------------------------ccccccCCCCcchHHHHHHHHHHHHHHcCCCccccCCHHHHHhcC
Confidence                                               111233355689999999999999999999999999999999999


Q ss_pred             ChhHHHHHHHHHHhhhh-------------hcCCChhhhhcCCce---eeeccccCCCCC
Q psy17184        159 DIAQVTNTIYALGREVF-------------LRDFSEEQLQAGKTI---IGLQAGSNKGAT  202 (218)
Q Consensus       159 n~~qV~~~l~~L~r~~~-------------~r~f~~~~l~~~~~~---i~lq~G~nk~as  202 (218)
                      |+.+|+.||++|++.+.             +|+||+++|++++.+   ||||||++...+
T Consensus       124 n~~~Vi~cL~aL~~~a~~~g~~P~~~~~~~~r~Fteeql~~~~~~l~~~glqm~~f~~~~  183 (190)
T 2rr8_A          124 NMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEEINNMKTELEKYGIQMPAFSKIG  183 (190)
T ss_dssp             CCHHHHHHHHHHHHHHHHSSCCCCCCCCTTSSCCCHHHHHHHHHHHHHSCCCCCCGGGCT
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCccccccCCCCCHHHHHHHHHHHHhhccCCCcchhHH
Confidence            99999999999999976             588999999999999   999999886543
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2ee7_A Sperm flagellar protein 1; all alpha protein, CH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1h67a_108 a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [T 3e-39
d1ujoa_144 a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [Ta 4e-36
d1p2xa_159 a.40.1.1 (A:) Ras GTPase-activating-like protein r 3e-32
d1pxya_ 500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 0.002
d1rt8a_ 505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 0.003
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 108 Back     information, alignment and structure

class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Calponin
species: Chicken (Gallus gallus) [TaxId: 9031]

 Score =  128 bits (324), Expect = 3e-39
 Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 69  PEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFM 128
           P+ +++ + WIE  TG++      + D +KDG ILC LINKL+PGSV K+N     +  +
Sbjct: 2   PQTERQLRVWIEGATGRRIGDN--FMDGLKDGVILCELINKLQPGSVQKVNDPVQNWHKL 59

Query: 129 ENINNFQKAIKDYGVADIDVFQTVDLYEKKDIAQVTNTIYALGR 172
           ENI NF +AIK YGV   D+F+  DL+E  +  QV +T+ AL  
Sbjct: 60  ENIGNFLRAIKHYGVKPHDIFEANDLFENTNHTQVQSTLIALAS 103
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 159 Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 99.98
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 99.97
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 99.95
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 99.79
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 99.57
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 99.3
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 98.82
d1rt8a_505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 98.6
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 98.52
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1rt8a_505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 98.24
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 98.13
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 98.12
d1pxya_500 Fimbrin (Plastin), actin-crosslinking domain {Thal 98.11
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 97.97
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 97.83
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 97.75
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 97.37
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 97.3
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 97.24
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 97.17
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 97.1
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 97.06
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 97.0
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 96.93
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 96.86
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 95.81
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 95.37
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 94.85
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 94.74
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Calponin
species: Chicken (Gallus gallus) [TaxId: 9031]

Probab=99.98  E-value=4.8e-33  Score=205.53  Aligned_cols=105  Identities=43%  Similarity=0.765  Sum_probs=100.4

Q ss_pred             hhhHHHHHHHHHHhhCCCCCCccchHHhhhchhHHHHHHHhhCCCCcccccCCCCccccchhHHHHHHHHHHhCCCccCc
Q psy17184         69 PEQDKEAQAWIETVTGQKFPAGVLYEDAIKDGQILCHLINKLKPGSVAKINSSGGQFKFMENINNFQKAIKDYGVADIDV  148 (218)
Q Consensus        69 ~~~e~~i~~wie~~l~~~l~~~d~f~~~l~dG~iLc~L~n~l~pg~i~ki~~~~~~f~~~eNI~~Fl~~~~~~Gv~~~~l  148 (218)
                      |+.+++++.||+.+++..+++  +|.+.|+||++||+|+|.+.||++++++.++.+|+++|||+.||++|+.+|||+.++
T Consensus         2 p~~e~e~~~Wie~~~~~~~~~--~~~~~L~dGv~LC~L~N~l~pg~i~ki~~~~~~f~~~eNI~~FL~~~~~~Gv~~~~l   79 (108)
T d1h67a_           2 PQTERQLRVWIEGATGRRIGD--NFMDGLKDGVILCELINKLQPGSVQKVNDPVQNWHKLENIGNFLRAIKHYGVKPHDI   79 (108)
T ss_dssp             CCSSHHHHHHHHHHHSCCCCS--CHHHHHHHCSHHHHHHHHHSTTSSTTCCCTTSSHHHHHHHHHHHHHHHHHTSCGGGS
T ss_pred             cHHHHHHHHHHHHHhCCCCch--HHHHHHcCchhHHHHHHHHHhcCCCccCCCcchhHHHHHHHHHHHHHHHhCCCcccC
Confidence            356789999999999999975  699999999999999999999999999999999999999999999999999999999


Q ss_pred             cccchhccccChhHHHHHHHHHHhhhh
Q psy17184        149 FQTVDLYEKKDIAQVTNTIYALGREVF  175 (218)
Q Consensus       149 F~~~DL~e~kn~~qV~~~l~~L~r~~~  175 (218)
                      |++.||||++|+.+|+.||++|+|.++
T Consensus        80 F~~~DL~e~kn~~~V~~cL~aL~r~a~  106 (108)
T d1h67a_          80 FEANDLFENTNHTQVQSTLIALASQAK  106 (108)
T ss_dssp             CCHHHHHHTCCSHHHHHHHHHHHHHHH
T ss_pred             CChHHHHhCCCHHHHHHHHHHHHHHhc
Confidence            999999999999999999999999986
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure