Diaphorina citri psyllid: psy17207


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MRLETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELSGKPNPAIFRSHPQGRLPNSYNITWMVSSYTPLEEFKIKYRKIPGNEPSPMSNQLTGTNQYQNRRLVRKITEN
ccccccccEEEEEcccEEEEEEccccccccCEEEEEEEcccccEEEEEEEEccccccEEEcccccccccCEEEEEEEcccccccEEEEEEEEcccccccccCEEECccCEEEEcEEEEEEccc
*RL*TTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELSGKPN**********RLPNSYNITWMVSSYTPLEEFKIKYRKIPGNEPSPMSNQLTGTNQYQNRRL*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELSGKPNPAIFRSHPQGRLPNSYNITWMVSSYTPLEEFKIKYRKIPGNEPSPMSNQLTGTNQYQNRRLVRKITEN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007156 [BP]homophilic cell adhesionprobableGO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 3-82
View the alignment between query and template
View the model in PyMOL
Template: 2NZI, chain A
Confidence level:very confident
Coverage over the Query: 2-105
View the alignment between query and template
View the model in PyMOL
Template: 3FL7, chain A
Confidence level:probable
Coverage over the Query: 24-123
View the alignment between query and template
View the model in PyMOL