Psyllid ID: psy17207


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MRLETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELSGKPNPAIFRSHPQGRLPNSYNITWMVSSYTPLEEFKIKYRKIPGNEPSPMSNQLTGTNQYQNRRLVRKITEN
ccccccccEEEEEcccEEEEEEccccccccEEEEEEEEcccccEEEEEEEEccccccEEEcccccccccEEEEEEEEcccccccEEEEEEEEcccccccccEEEEEccEEEEEcEEEEEEccc
cccccccEEEEEcccccEEEEEEEccHHHcccEEEEEEcccccEEEEEEEEccccccEEEccccccccccEEEEEEEEcccccEEEEEEEEEccccccccccccccccccccccEcccccccc
MRLETTERRIMETRGSRHTLMIRKVVAsdfgnysceatnpmgkhraylelsgkpnpaifrshpqgrlpnsynitwmvssytpleefkikyrkipgnepspmsnqltgtnqyqNRRLVRKITEN
mrletterrimetrgsrhtlmiRKVVASDFGNYSCEATNPMGKHRAYLELSGKPNPAIFRSHPQGRLPNSYNITWMVSSYTPLEEFKIKYRKIPgnepspmsnqltgtnqyqnrrlvrkiten
MRLETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELSGKPNPAIFRSHPQGRLPNSYNITWMVSSYTPLEEFKIKYRKIPGNEPSPMSNQLTGTNQYQNRRLVRKITEN
******************TLMIRKVVASDFGNYSCEATNPMGKHRAYLE****************RLPNSYNITWMVSSYTPLEEFKIKYRK*******************************
*RL*TTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELSGKPN*************NSYNITWMVSSYTPLEEFKIKYRKIPGNEPSPMSNQLTGTNQYQNRRL*******
MRLETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELSGKPNPAIFRSHPQGRLPNSYNITWMVSSYTPLEEFKIKYRKIPGNEPSPMSNQLTGTNQYQNRRLVRKITEN
****TTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELSGKPNPAIFRSHPQGRLPNSYNITWMVSSYTPLEEFKIKYRKIPGNEPSPMSNQLTGTNQYQNRRLVR*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELSGKPNPAIFRSHPQGRLPNSYNITWMVSSYTPLEEFKIKYRKIPGNEPSPMSNQLTGTNQYQNRRLVRKITEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
242018223 500 limbic system-associated membrane protei 0.756 0.186 0.709 2e-33
328701973 535 PREDICTED: neural cell adhesion molecule 0.878 0.201 0.598 4e-31
328701975 551 PREDICTED: neural cell adhesion molecule 0.878 0.196 0.598 4e-31
242021179 454 limbic system-associated membrane protei 0.788 0.213 0.656 5e-31
270003594 240 hypothetical protein TcasGA2_TC002850 [T 0.845 0.433 0.554 8e-29
91079206 551 PREDICTED: similar to CG34353 CG34353-PA 0.845 0.188 0.554 1e-28
195352945 271 GM16324 [Drosophila sechellia] gi|194127 0.764 0.346 0.617 5e-28
92109994 518 IP03437p [Drosophila melanogaster] 0.788 0.187 0.602 2e-27
161078695 566 CG34353, isoform A [Drosophila melanogas 0.788 0.171 0.602 2e-27
108743667 413 IP03330p [Drosophila melanogaster] 0.764 0.227 0.606 3e-27
>gi|242018223|ref|XP_002429579.1| limbic system-associated membrane protein precursor, putative [Pediculus humanus corporis] gi|212514537|gb|EEB16841.1| limbic system-associated membrane protein precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 66/93 (70%), Positives = 78/93 (83%)

Query: 1   MRLETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELSGKPNPAIFR 60
           +RL+TTERR ME RGSRHTL+IRKV ASDFGNYSC A NP+GK R YL+LSGKPN  +FR
Sbjct: 260 LRLDTTERRSMEVRGSRHTLIIRKVQASDFGNYSCVADNPLGKMRQYLQLSGKPNQVVFR 319

Query: 61  SHPQGRLPNSYNITWMVSSYTPLEEFKIKYRKI 93
           S P GR  +SYNITW V+SYTP+EEFK+ +RK+
Sbjct: 320 SEPMGRYKDSYNITWAVNSYTPIEEFKLYFRKL 352




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328701973|ref|XP_001945384.2| PREDICTED: neural cell adhesion molecule 1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328701975|ref|XP_003241763.1| PREDICTED: neural cell adhesion molecule 1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242021179|ref|XP_002431023.1| limbic system-associated membrane protein precursor, putative [Pediculus humanus corporis] gi|212516252|gb|EEB18285.1| limbic system-associated membrane protein precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270003594|gb|EFA00042.1| hypothetical protein TcasGA2_TC002850 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91079206|ref|XP_969693.1| PREDICTED: similar to CG34353 CG34353-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195352945|ref|XP_002042971.1| GM16324 [Drosophila sechellia] gi|194127036|gb|EDW49079.1| GM16324 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|92109994|gb|ABE73321.1| IP03437p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|161078695|ref|NP_001097949.1| CG34353, isoform A [Drosophila melanogaster] gi|386766647|ref|NP_001247342.1| CG34353, isoform B [Drosophila melanogaster] gi|158030420|gb|ABW08787.1| CG34353, isoform A [Drosophila melanogaster] gi|383292993|gb|AFH06659.1| CG34353, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|108743667|gb|ABG02142.1| IP03330p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
FB|FBgn0017590545 klg "klingon" [Drosophila mela 0.772 0.174 0.526 1.7e-23
FB|FBgn0037107467 CG7166 [Drosophila melanogaste 0.772 0.203 0.442 8.5e-18
FB|FBgn0025878 500 wrapper "wrapper" [Drosophila 0.650 0.16 0.362 5.8e-12
UNIPROTKB|G3N022 3281 SPEG "Uncharacterized protein" 0.422 0.015 0.365 9.8e-05
ZFIN|ZDB-GENE-010822-1 840 ncam2 "neural cell adhesion mo 0.430 0.063 0.333 0.00012
UNIPROTKB|F1Q2N4 1622 ROBO1 "Uncharacterized protein 0.317 0.024 0.487 0.00024
MGI|MGI:109282 3262 Speg "SPEG complex locus" [Mus 0.422 0.015 0.346 0.00031
UNIPROTKB|F6X4X4 3272 SPEG "Uncharacterized protein" 0.422 0.015 0.346 0.0004
UNIPROTKB|E2R2D8 3274 SPEG "Uncharacterized protein" 0.422 0.015 0.346 0.0004
MGI|MGI:107935 1091 Lrig1 "leucine-rich repeats an 0.422 0.047 0.407 0.00068
FB|FBgn0017590 klg "klingon" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 277 (102.6 bits), Expect = 1.7e-23, P = 1.7e-23
 Identities = 50/95 (52%), Positives = 67/95 (70%)

Query:     3 LETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELSGKPNPAIFRSH 62
             +++T+RRIM TR +RH L IR +   DFGNYSC A N +G+ R Y+ELSG+P  A F S 
Sbjct:   328 IQSTDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSP 387

Query:    63 PQGRLPNSYNITWMVSSYTPLEEFKIKYRKIPGNE 97
               GR P+SYN+TW + SY PLEE ++ YR++  NE
Sbjct:   388 KWGRSPDSYNLTWKIDSYPPLEEVRLLYRRVQMNE 422




GO:0019897 "extrinsic to plasma membrane" evidence=ISS
GO:0007465 "R7 cell fate commitment" evidence=IGI
GO:0045466 "R7 cell differentiation" evidence=IMP
GO:0007156 "homophilic cell adhesion" evidence=IDA
GO:0007611 "learning or memory" evidence=IMP
GO:0008355 "olfactory learning" evidence=IMP
GO:0048149 "behavioral response to ethanol" evidence=IMP
GO:0007616 "long-term memory" evidence=IMP
GO:0007615 "anesthesia-resistant memory" evidence=IMP
FB|FBgn0037107 CG7166 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0025878 wrapper "wrapper" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G3N022 SPEG "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-010822-1 ncam2 "neural cell adhesion molecule 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2N4 ROBO1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:109282 Speg "SPEG complex locus" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F6X4X4 SPEG "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2D8 SPEG "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:107935 Lrig1 "leucine-rich repeats and immunoglobulin-like domains 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 2e-06
smart0041085 smart00410, IG_like, Immunoglobulin like 3e-05
smart0040985 smart00409, IG, Immunoglobulin 3e-05
cd0009674 cd00096, Ig, Immunoglobulin domain 1e-04
cd0572569 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like 2e-04
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 2e-04
cd0574378 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)- 4e-04
cd0573171 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig 0.004
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
 Score = 43.0 bits (102), Expect = 2e-06
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 3  LETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLEL 50
          L +++R  +   G  +TL I  V   D G Y+C ATN  G+  A  EL
Sbjct: 41 LRSSDRFKVTYEGGTYTLTISNVQPDDEGKYTCVATNSAGEAEASAEL 88


Length = 90

>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|143220 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>gnl|CDD|143208 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.37
KOG3513|consensus 1051 99.3
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.25
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.22
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.17
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.14
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.14
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.13
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.11
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.1
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.09
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.09
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.08
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.07
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.05
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.05
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.05
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.04
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.03
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.03
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.03
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.02
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.01
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.01
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.01
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.01
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 98.98
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 98.95
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 98.94
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 98.93
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 98.93
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 98.92
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 98.9
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 98.89
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 98.89
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 98.88
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 98.86
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 98.86
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 98.86
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 98.85
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 98.85
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 98.84
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 98.83
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 98.83
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 98.83
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 98.82
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 98.82
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 98.82
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 98.81
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 98.8
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 98.8
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 98.8
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 98.77
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 98.77
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 98.76
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 98.76
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 98.76
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 98.75
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 98.7
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 98.7
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 98.67
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 98.64
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 98.64
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 98.64
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 98.62
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 98.6
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 98.59
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 98.58
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 98.53
KOG3513|consensus 1051 98.52
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 98.5
PHA02785326 IL-beta-binding protein; Provisional 98.49
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 98.48
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.48
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 98.48
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 98.47
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 98.45
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 98.44
PHA02826227 IL-1 receptor-like protein; Provisional 98.43
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 98.4
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 98.36
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 98.36
KOG4221|consensus 1381 98.33
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 98.32
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 98.31
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.3
smart0040986 IG Immunoglobulin. 98.29
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.29
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 98.28
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.28
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.27
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 98.27
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 98.26
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 98.24
KOG4194|consensus873 98.18
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 98.17
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 98.16
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.13
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.12
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 98.12
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.09
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.09
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.08
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 98.08
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 98.08
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.07
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 98.03
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 97.99
smart0040863 IGc2 Immunoglobulin C-2 Type. 97.96
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 97.95
KOG4222|consensus 1281 97.93
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 97.9
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 97.88
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 97.82
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 97.82
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 97.8
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 97.79
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 97.76
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 97.74
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 97.74
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 97.7
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 97.69
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 97.68
PHA02785 326 IL-beta-binding protein; Provisional 97.65
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 97.63
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 97.63
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 97.63
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 97.61
PHA02826227 IL-1 receptor-like protein; Provisional 97.61
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 97.61
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 97.6
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 97.6
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 97.52
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 97.51
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 97.5
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 97.5
PF0004764 ig: Immunoglobulin domain The Prosite family only 97.48
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 97.47
PHA0263363 hypothetical protein; Provisional 97.45
smart0040681 IGv Immunoglobulin V-Type. 97.42
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 97.38
KOG4221|consensus 1381 97.38
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 97.35
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 97.34
KOG4222|consensus 1281 97.27
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 97.2
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 97.16
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 97.14
KOG4194|consensus 873 97.1
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.04
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 96.94
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 96.77
PHA03376221 BARF1; Provisional 96.55
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 96.52
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 96.5
PHA02987189 Ig domain OX-2-like protein; Provisional 96.36
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 96.36
PHA02982251 hypothetical protein; Provisional 96.21
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 96.11
PF07354 271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 95.03
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 94.73
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 93.71
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 93.63
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 92.78
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 92.27
KOG3515|consensus 741 91.66
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 90.09
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 89.99
KOG1480|consensus 909 89.77
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 87.5
PHA03042 286 CD47-like protein; Provisional 86.7
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 85.88
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 85.74
cd0006393 FN3 Fibronectin type 3 domain; One of three types 83.1
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 81.58
KOG3515|consensus 741 81.22
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 81.09
smart0006083 FN3 Fibronectin type 3 domain. One of three types 80.96
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 80.45
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 80.37
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
Probab=99.37  E-value=2.5e-12  Score=82.84  Aligned_cols=56  Identities=25%  Similarity=0.437  Sum_probs=48.6

Q ss_pred             ccccCCCEEEEEcCCEEEEEEcccCCCCCeeEEEEEEcCCceeEEEEEEe--ccCCCc
Q psy17207          2 RLETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELS--GKPNPA   57 (123)
Q Consensus         2 ~l~~d~R~~i~~~~~~~~L~I~~v~~~D~G~YtC~A~N~~G~~~~~i~l~--~~P~p~   57 (123)
                      +|..++|+.+......+.|+|.++..+|+|.|+|.|+|.+|.+.+++.|.  ++|.||
T Consensus        40 ~l~~~~~~~~~~~~~~s~L~I~~~~~~D~G~Ytc~a~N~~G~~~~~~~l~V~~~P~pP   97 (98)
T cd05762          40 QIQEGEGIKIENTENSSKLTITEGQQEHCGCYTLEVENKLGSRQAQVNLTVVDKPDPP   97 (98)
T ss_pred             EecCCCcEEEEecCCeeEEEECCCChhhCEEEEEEEEcCCCceeEEEEEEEecCCCCC
Confidence            56778899888777789999999999999999999999999999876665  577765



Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II. Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin. This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has

>KOG3513|consensus Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 3e-11
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 3e-10
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 5e-09
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 5e-09
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-08
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 6e-08
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 4e-11
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 1e-10
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 2e-05
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 2e-10
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 2e-07
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 2e-10
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 2e-10
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 1e-08
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-10
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 1e-07
2y25_A 317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-07
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 5e-10
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 9e-08
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 5e-10
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 1e-09
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 1e-09
2y23_A 312 Myomesin; structural protein, sarcomere, M-BAND, i 1e-09
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-08
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 4e-07
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 2e-09
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 3e-06
2wim_A 291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 2e-09
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 2e-08
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 5e-04
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 2e-09
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 2e-09
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 2e-09
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 3e-09
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 5e-07
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 3e-09
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 4e-09
2rik_A 284 Titin; I-SET IG fold, poly-IG linear array, struct 1e-08
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 2e-08
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 6e-09
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 6e-09
1wwb_X103 Protein (brain derived neurotrophic factor recepto 6e-09
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 8e-09
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 9e-09
2nzi_A 305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-07
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 1e-08
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 1e-08
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 6e-08
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 1e-08
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 2e-06
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 1e-08
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 2e-08
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 3e-07
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 2e-08
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 2e-08
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 2e-08
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 2e-08
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 2e-08
1waa_A93 Titin; metal binding protein, calmodulin-binding, 3e-08
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 3e-08
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 3e-08
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 3e-08
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 4e-08
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 4e-08
1ry7_B 334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 3e-05
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 4e-05
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 4e-08
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 5e-08
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 6e-08
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 8e-06
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 7e-08
4dkd_C 292 Macrophage colony-stimulating factor 1 receptor; d 7e-08
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 3e-07
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 8e-08
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 8e-08
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-06
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-05
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-05
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 4e-05
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-04
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 9e-04
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 9e-08
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 1e-07
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 1e-07
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 2e-07
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 1e-07
3qs7_E 423 FL cytokine receptor; immunoglobulin-like domain, 1e-07
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 7e-06
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-04
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 1e-07
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 1e-06
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 1e-07
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 1e-07
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 1e-04
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 1e-07
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 2e-07
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 1e-05
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 3e-04
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 2e-07
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 2e-07
3ejj_X 289 Macrophage colony-stimulating factor 1 receptor; g 5e-07
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 2e-07
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 2e-05
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 2e-07
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 2e-05
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 2e-07
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 2e-07
2yd9_A 304 Receptor-type tyrosine-protein phosphatase S; hydr 2e-05
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 5e-05
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 2e-07
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 5e-07
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 3e-07
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 3e-07
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 3e-07
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 8e-04
1qz1_A 291 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-07
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-06
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 1e-04
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 3e-07
2ens_A96 Advanced glycosylation END product-specific recept 4e-07
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 4e-07
3u83_A 331 Poliovirus receptor-related protein 1; nectin-1, h 9e-04
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 4e-07
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 5e-07
3o4o_C 339 Interleukin-1 receptor type 2; cytokine-receptor c 5e-07
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 3e-05
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 3e-05
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 5e-07
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 6e-06
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 5e-07
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 5e-07
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 9e-06
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 3e-05
1he7_A126 High affinity nerve growth factor receptor; transf 6e-07
1itb_B 315 Type 1 interleukin-1 receptor; immunoglobulin fold 6e-07
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 9e-05
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 2e-04
3laf_A 403 Deleted in colorectal cancer; netrin-1 receptor, i 6e-07
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-06
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-06
3laf_A 403 Deleted in colorectal cancer; netrin-1 receptor, i 3e-04
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 7e-07
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 7e-07
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-05
1cs6_A 382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-05
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 7e-07
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 4e-04
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 8e-07
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 3e-05
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 9e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-07
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 1e-06
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 1e-06
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 1e-06
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 3e-06
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 6e-06
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 1e-05
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 4e-05
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 8e-05
1gl4_B98 Basement membrane-specific heparan sulfate proteog 1e-06
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-06
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 6e-05
3p3y_A 404 Neurofascin; IG domains, cell adhesion; HET: NAG; 2e-04
3p3y_A 404 Neurofascin; IG domains, cell adhesion; HET: NAG; 5e-04
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 1e-06
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 2e-06
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 2e-04
3mjg_X289 Beta-type platelet-derived growth factor receptor; 2e-06
3mjg_X 289 Beta-type platelet-derived growth factor receptor; 8e-04
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 2e-06
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-06
3kld_A 384 Contactin 4, axcam, BIG-2; cell adhesion, protein 3e-06
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-05
3kld_A 384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-04
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 2e-06
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 3e-06
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 1e-04
2v5m_A 388 Dscam; neurobiology SPL immunoglobulin domain, cel 4e-04
2v5m_A 388 Dscam; neurobiology SPL immunoglobulin domain, cel 8e-04
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 3e-06
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 3e-06
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 3e-06
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 6e-06
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 6e-05
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-04
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 3e-06
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 4e-05
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 3e-06
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 1e-04
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 3e-06
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 1e-05
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 4e-06
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 5e-06
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-05
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 4e-05
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 8e-05
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-04
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 4e-06
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 4e-06
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 5e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-06
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 5e-06
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 5e-06
4dep_C 349 Interleukin-1 receptor accessory protein; B-trefoi 5e-06
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 9e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-06
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 1e-05
1wio_A 363 CD4, T-cell surface glycoprotein CD4; immunoglobul 2e-05
1wio_A 363 CD4, T-cell surface glycoprotein CD4; immunoglobul 4e-05
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 1e-05
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 1e-05
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 1e-05
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 2e-04
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 2e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-05
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 3e-05
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 5e-05
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 3e-05
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 5e-04
3s35_X122 Vascular endothelial growth factor receptor 2; ant 5e-05
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 5e-05
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 6e-05
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 9e-05
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 9e-05
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 1e-04
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 1e-04
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 7e-04
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-04
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 2e-04
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 3e-04
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 4e-04
2v9t_A117 Roundabout homolog 1; structural protein-receptor 4e-04
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 5e-04
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 5e-04
2fbo_J250 V1V2;, variable region-containing chitin-binding p 5e-04
2fbo_J250 V1V2;, variable region-containing chitin-binding p 6e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-04
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 8e-04
1eaj_A126 Coxsackie virus and adenovirus receptor; virus/vir 9e-04
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
 Score = 58.3 bits (141), Expect = 3e-11
 Identities = 19/64 (29%), Positives = 25/64 (39%), Gaps = 2/64 (3%)

Query: 3   LETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMG--KHRAYLELSGKPNPAIFR 60
           L+           +  TL I +   S  G Y+C A+NP+G     A L LS    P  F 
Sbjct: 142 LKDDANLQTSFIHNVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLTLSEHEVPPFFD 201

Query: 61  SHPQ 64
             P 
Sbjct: 202 LKPV 205


>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Length = 117 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B Length = 126 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.47
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.4
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.27
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.23
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.15
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.13
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.1
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.06
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.04
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.04
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.0
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 98.99
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 98.99
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 98.98
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 98.98
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 98.98
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 98.97
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 98.97
1he7_A126 High affinity nerve growth factor receptor; transf 98.97
1waa_A93 Titin; metal binding protein, calmodulin-binding, 98.95
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 98.95
1wwb_X103 Protein (brain derived neurotrophic factor recepto 98.94
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 98.94
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 98.93
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 98.92
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 98.91
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 98.9
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 98.9
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 98.9
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 98.89
2rik_A 284 Titin; I-SET IG fold, poly-IG linear array, struct 98.89
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 98.89
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 98.88
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 98.88
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 98.88
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 98.88
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 98.88
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 98.88
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 98.88
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 98.87
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 98.87
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 98.87
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 98.86
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 98.85
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 98.84
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 98.84
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 98.84
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 98.83
2y23_A 312 Myomesin; structural protein, sarcomere, M-BAND, i 98.83
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 98.83
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 98.81
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 98.81
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 98.81
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 98.81
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 98.81
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 98.8
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 98.8
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 98.79
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 98.79
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 98.79
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 98.79
2wim_A 291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 98.78
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 98.78
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 98.77
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 98.77
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 98.77
3sob_L237 Antibody light chain; beta propeller, protein bind 98.77
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 98.77
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 98.76
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 98.76
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 98.76
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 98.75
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 98.75
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 98.75
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 98.75
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 98.74
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 98.74
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 98.74
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 98.73
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 98.73
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 98.73
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 98.72
3ux9_B256 SCFV antibody; five helices, long loop connecting 98.72
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 98.72
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 98.71
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 98.71
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 98.71
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 98.71
1nqb_A256 Single-chain antibody fragment; multivalent antibo 98.7
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 98.7
2wng_A 327 Tyrosine-protein phosphatase non-receptor type sub 98.7
2d9q_B 313 Granulocyte colony-stimulating factor receptor; cy 98.69
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 98.69
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 98.69
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 98.69
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 98.69
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 98.69
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 98.69
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 98.69
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 98.69
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 98.68
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 98.68
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 98.68
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 98.68
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 98.67
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 98.67
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 98.67
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 98.67
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 98.66
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 98.66
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 98.65
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 98.65
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 98.64
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.64
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 98.64
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 98.64
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 98.64
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 98.64
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 98.63
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 98.63
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 98.62
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 98.62
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 98.62
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 98.62
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 98.62
3umt_A256 SCFV heavy chain and light chain; stability engine 98.61
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 98.61
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 98.61
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 98.61
3s35_X122 Vascular endothelial growth factor receptor 2; ant 98.61
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 98.61
1qgc_4 438 Protein (immunoglobulin); virus-antibody complex, 98.61
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 98.61
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 98.6
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 98.6
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 98.6
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 98.6
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 98.6
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 98.59
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 98.59
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 98.59
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 98.59
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 98.59
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 98.59
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 98.58
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 98.58
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.58
2fbo_J250 V1V2;, variable region-containing chitin-binding p 98.58
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 98.58
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 98.58
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 98.58
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 98.57
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 98.57
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 98.57
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 98.57
3khq_A133 B-cell antigen receptor complex-associated protei 98.57
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 98.56
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 98.56
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 98.55
3eow_R221 Poliovirus receptor; immunoglobulin super family, 98.54
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 98.53
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 98.53
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 98.53
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 98.53
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 98.52
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 98.52
1qz1_A 291 Neural cell adhesion molecule 1, 140 kDa isoform; 98.52
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 98.51
2nzi_A 305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 98.51
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 98.51
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 98.5
2yd9_A 304 Receptor-type tyrosine-protein phosphatase S; hydr 98.5
1gl4_B98 Basement membrane-specific heparan sulfate proteog 98.5
1za6_B 344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 98.5
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 98.5
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 98.5
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 98.5
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 98.5
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 98.5
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 98.49
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 98.49
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 98.48
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 98.48
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 98.48
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 98.47
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 98.47
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 98.46
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 98.46
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 98.46
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 98.46
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 98.46
3qs7_E 423 FL cytokine receptor; immunoglobulin-like domain, 98.45
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 98.45
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 98.45
3ejj_X 289 Macrophage colony-stimulating factor 1 receptor; g 98.45
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 98.45
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 98.45
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 98.45
1zox_A113 CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid I 98.45
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 98.44
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 98.44
1i1r_A 303 GP130, interleukin-6 receptor beta chain; cytokine 98.44
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 98.44
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 98.44
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 98.44
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 98.43
4dkd_C 292 Macrophage colony-stimulating factor 1 receptor; d 98.43
1pko_A139 Myelin oligodendrocyte glycoprotein; IGV-domain, i 98.43
2qsq_A111 Carcinoembryonic antigen-related cell adhesion MO; 98.43
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 98.42
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 98.42
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 98.42
1c5d_H215 Monoclonal antibody against the main immunogenic t 98.42
4fom_A 308 Poliovirus receptor-related protein 3; immunoglobu 98.42
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 98.41
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 98.41
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 98.41
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 98.41
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 98.4
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 98.4
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 98.4
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 98.4
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 98.4
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 98.39
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 98.39
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 98.38
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 98.38
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 98.38
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 98.38
1hzh_H 457 IGG, immunoglobulin heavy chain; antibody, immune 98.38
1bec_A238 14.3.D T cell antigen receptor; T cell receptor; 1 98.38
1eaj_A126 Coxsackie virus and adenovirus receptor; virus/vir 98.37
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 98.37
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 98.37
4gos_A125 V-SET domain-containing T-cell activation inhibit; 98.37
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 98.37
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 98.36
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 98.36
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 98.36
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.36
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 98.36
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 98.36
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 98.35
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 98.35
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 98.35
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 98.35
2or8_A116 Hepatitis A virus cellular receptor 1 homolog; bet 98.34
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 98.34
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 98.34
3mjg_X 289 Beta-type platelet-derived growth factor receptor; 98.33
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 98.33
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.33
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 98.31
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 98.31
1jhl_L108 IGG1-kappa D11.15 FV (light chain); complex(antibo 98.31
1neu_A124 Myelin P0 protein; structural protein, glycoprotei 98.3
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 98.3
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 98.29
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 98.29
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 98.29
3rrq_A129 Protein PD-1, programmed cell death protein 1; pro 98.28
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 98.28
2q87_A110 CMRF35-H antigen; all-beta, immunoglobulin, IG-sup 98.28
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 98.28
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 98.27
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 98.27
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 98.26
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 98.26
1iga_A 475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 98.26
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 98.26
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 98.25
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 98.25
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 98.25
4dep_C 349 Interleukin-1 receptor accessory protein; B-trefoi 98.24
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 98.24
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 98.24
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 98.23
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 98.23
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 98.23
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 98.23
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 98.23
3rjd_A 262 High affinity immunoglobulin gamma FC receptor I; 98.23
3n9g_H230 FAB fragment of MAB CR4354, heavy chain; human neu 98.23
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 98.22
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 98.22
4fqp_A 313 Poliovirus receptor; immunoglobulin-like domain, I 98.22
1igt_B 444 IGG2A intact antibody - MAB231; intact immunoglobu 98.22
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 98.22
3udw_C118 Poliovirus receptor; PVR tigit IGSF signal transdu 98.21
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 98.21
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 98.21
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 98.21
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 98.21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.21
3mjg_X289 Beta-type platelet-derived growth factor receptor; 98.2
1n26_A 325 IL-6 receptor alpha chain; transmembrane, glycopro 98.2
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 98.18
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 98.18
3vh8_G 316 Killer cell immunoglobulin-like receptor 3DL1; imm 98.17
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 98.17
3u83_A 331 Poliovirus receptor-related protein 1; nectin-1, h 98.17
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 98.17
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 98.14
1ypz_E207 T cell receptor delta, beta-2-microglobulin; H2-T2 98.13
2or7_A115 T-cell immunoglobulin and mucin domain- containing 98.13
2oyp_A109 Hepatitis A virus cellular receptor 2; TIM-3, T-ce 98.13
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 98.13
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 98.13
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 98.12
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 98.12
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 98.12
2q20_A109 VK1 O18/O8 germline light chain variable domain; A 98.12
3iu4_H263 CHP3 FAB heavy chain; antibody, ganglioside, idiot 98.12
3u2s_H248 PG9 heavy chain; greek KEY, immunoglobulin, immune 98.11
1oga_E252 TRBC1, T-cell receptor beta chain C region; immune 98.11
2v5m_A 388 Dscam; neurobiology SPL immunoglobulin domain, cel 98.11
1wio_A 363 CD4, T-cell surface glycoprotein CD4; immunoglobul 98.11
1h5b_A113 Murine T cell receptor (TCR) valpha domain; immune 98.1
1i8k_A107 Epidermal growth factor receptor antibody MR1SCFV 98.09
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 98.09
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 98.09
3kg5_A134 B-cell antigen receptor complex-associated protei 98.09
3sob_H256 Antibody heavy chain, low-density lipoprotein rece 98.09
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 98.09
1j05_L111 T84.66 antibody, anti-CEA MAB T84.66, light chain; 98.08
1ncn_A110 T lymphocyte activation antigen CD86; IG V, beta s 98.08
1igy_B 434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 98.08
3p3y_A 404 Neurofascin; IG domains, cell adhesion; HET: NAG; 98.08
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 98.08
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 98.08
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 98.08
1xt5_A135 Variable region-containing chitin-binding protein 98.08
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 98.07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.07
2e27_L119 Anti-ciguatoxin antibody, light chain; immunoglobu 98.07
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 98.06
1qfw_M108 FV, antibody (anti beta subunit) (light chain); gl 98.06
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 98.06
1mqk_L120 Antibody 7E2 FV fragment, light chain; membrane pr 98.06
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 98.05
3oq3_B 329 IFN-alpha/beta binding protein C12R; mousepox viru 98.04
1ypz_F230 T-cell receptor gamma chain, beta-2-microglobulin; 98.04
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 98.03
3mlr_H226 Human monoclonal anti-HIV-1 GP120 V3 antibody 255 98.03
2wqr_A323 IG epsilon chain C region; immune system, immunogl 98.03
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 98.03
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 98.02
3f8u_B401 Tapasin; endoplasmic reticulum, glycoprotein, immu 98.02
3o4o_C 339 Interleukin-1 receptor type 2; cytokine-receptor c 98.02
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 98.02
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 98.02
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 98.02
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.01
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 98.0
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 98.0
3to4_D253 NKT vbeta2 (mouse variable domain, human constant; 97.99
1eeq_A114 Kappa-4 immunoglobulin (light chain); protein stab 97.99
2fbo_J250 V1V2;, variable region-containing chitin-binding p 97.99
2v9t_A117 Roundabout homolog 1; structural protein-receptor 97.99
1kgc_D206 T-cell receptor alpha chain; LC13 clone, immune sy 97.99
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 97.99
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 97.98
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 97.98
2nms_A124 CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP4 97.97
1pew_A109 JTO2, A lambda-6 type immunoglobulin light chain, 97.97
2qhl_A111 Novel immune-type receptor 10; immunoglobulin vari 97.97
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 97.97
2h32_A126 Immunoglobulin IOTA chain; beta sheets, V and C-ty 97.96
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 97.96
1i3g_L111 Antibody FV fragment; antibiotic; 2.44A {Mus muscu 97.96
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 97.95
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 97.94
3umt_A256 SCFV heavy chain and light chain; stability engine 97.93
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 97.92
1dlf_L113 Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 97.92
2ens_A96 Advanced glycosylation END product-specific recept 97.92
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 97.92
2bnu_A203 TCR alpha chain, T-cell receptor alpha chain C reg 97.9
4ffy_L126 DENV1-E111 single chain variable fragment (light; 97.9
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 97.89
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 97.89
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 97.89
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 97.89
4gjt_B123 Poliovirus receptor-related protein 4; six-bladed 97.88
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 97.88
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 97.88
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 97.87
1nqb_A256 Single-chain antibody fragment; multivalent antibo 97.87
2otu_A115 FV light chain variable domain; antibody FV polygl 97.87
1oaq_L120 Light chain; antibody, allergy, IGE, conformationa 97.86
2ywz_A111 NEW antigen receptor variable domain; IG VNAR, imm 97.86
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 97.86
1tvd_A116 T cell receptor, ES204 V delta; immunoreceptor, TC 97.85
2edo_A121 CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte 97.85
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 97.84
1zvo_C 512 Myeloma immunoglobulin D delta; immunoglobulin fol 97.84
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 97.84
2ptt_A110 CD48 antigen; CD244, CD48, NK cell receptor, X-RAY 97.83
2coq_A108 NEW antigen receptor variable domain; IG VNAR, nat 97.83
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 97.82
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 97.82
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 97.82
2frg_P106 TREM-like transcript-1; immunoglobulin-like, beta- 97.82
2ak4_D211 SB27 T cell receptor alpha chain; bulged epitopes, 97.82
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 97.82
2hp4_A114 T-cell surface glycoprotein CD8 alpha chain; CO-re 97.81
2eys_A210 NKT15; natural killer T cell receptor, immune syst 97.81
1nko_A132 Sialic acid binding IG-like lectin 7; immunoglobul 97.81
2d9c_A136 Signal-regulatory protein beta-1; beta-sandwich, S 97.81
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 97.8
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 97.79
3bdb_A137 Novel immune-type receptor 11; immunoglobulin vari 97.79
2nw2_A200 ELS4 TCR alpha chain; T cell receptor, immune syst 97.79
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 97.78
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 97.78
2wqr_A 323 IG epsilon chain C region; immune system, immunogl 97.77
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 97.77
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 97.76
3u1s_H267 FAB PGT145 heavy chain; IGG, broadly neutralizing 97.76
3r0n_A128 Poliovirus receptor-related protein 2; IG-domain, 97.76
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 97.75
1u9k_A114 Triggering receptor expressed on myeloid cells 1; 97.75
1u3h_A110 T-cell receptor alpha-chain; complex, immune syste 96.94
1lp9_E194 T-cell receptor alpha chain; immunoregulatory comp 97.74
1hxm_A229 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 97.74
2yc1_B146 Single chain antibody fragment 9004G; immune syste 97.74
1fo0_B112 Protein (BM3.3 T cell receptor beta-chain); class 97.73
3eow_R221 Poliovirus receptor; immunoglobulin super family, 97.73
3bp6_A117 Programmed cell death protein 1; PD-1, PD-L2, comp 97.73
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 97.72
2q7n_A 488 Leukemia inhibitory factor receptor; cytokine cell 97.72
3t0v_A123 Immunoglobulin variable lambda domain; immunoglobu 97.72
1ow0_A214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 97.72
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 97.72
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 97.72
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 97.72
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 97.71
1sq2_N113 Novel antigen receptor; immunoglobulin fold, prote 97.71
3u6r_L143 Antibody 1:7 (light chain); IG-like domain, neutra 97.71
1dlf_H124 Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 97.7
3ux9_B256 SCFV antibody; five helices, long loop connecting 97.69
1fo0_A116 Protein (BM3.3 T cell receptor alpha-chain); class 97.69
2atp_B115 T-cell surface glycoprotein CD8 beta chain; CD8AB, 97.69
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 97.69
3rgv_A200 YAE62 TCR A chain; TCR, MHC, MHC class I, immune s 97.68
3moq_A126 NEW antigen receptor variable domain, P3(40) PEPT 97.68
1oga_D215 T-cell receptor alpha chain V region, beta-2-micro 97.68
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 97.68
1p4b_L135 Antibody variable light chain; FV antibody, antige 97.68
3mbe_C229 I-AG7; T cell receptor, histocompatability antigen 97.66
3bj9_1116 Immunoglobulin IOTA chain, immunoglobulin lambda- 97.65
1mfa_H120 IGG1-lambda Se155-4 FAB (heavy chain); immunoglobu 97.64
3bia_X116 T-cell immunoglobulin and mucin domain- containing 97.64
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 97.64
1sjv_A114 R9; camelids antibody, domain swapping, heavy chai 97.64
2yc1_A117 Single chain antibody fragment 9004G; immune syste 97.64
3b9v_A120 Heavy chain variable domain; antibody engineering, 97.64
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 97.63
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 97.63
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 97.63
1kxv_C121 Camelid VHH domain CAB10; beta 8 alpha 8, beta bar 97.63
1hzh_H 457 IGG, immunoglobulin heavy chain; antibody, immune 97.62
3bik_B134 Programmed cell death protein 1; CO-stimulation, r 97.62
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 97.61
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 97.61
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 97.6
3c6l_A185 TCR 2W20 alpha chain; TCR-PMHC complex; 3.40A {Mus 96.76
1n4x_H120 Immunoglobulin heavy chain variable region; immune 97.59
1a2y_B116 IGG1-kappa D1.3 FV (heavy chain); complex (immunog 97.58
1j05_H121 T84.66 antibody, anti-CEA MAB T84.66, heavy chain; 97.58
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 97.57
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 97.57
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 97.57
1hkf_A122 NKP44, NK cell activating receptor; natural cytoto 97.53
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 97.53
2wzp_D123 Camelid VHH5; baseplate, viral protein; 2.60A {Lam 97.53
1igy_B 434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 97.52
2q86_A229 Valpha14 TCR; INKT cells, TCR, glycolipid recognit 97.51
1xiw_D122 Immunoglobulin heavy chain variable region; CD3-ep 97.51
3gsn_A199 RA14 TCR alpha chain (TRAV24, TRAJ49); HLA, human 97.51
1kxt_B127 Immunoglobulin VHH fragment; alpha 8 beta 8, beta 97.51
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 97.51
3tjh_C226 42F3 alpha; IG MHC, antigen recognition, TCR-PMHC, 97.51
2p45_B123 Antibody CAB-RN05; seMet phasing, camelid single-d 97.5
1yc7_A124 Anti-VSG immunoglobulin heavy chain variable domai 97.5
1xau_A122 B- and T-lymphocyte attenuator; IG domain, beta sa 97.49
2oi9_C121 V beta, T cell receptor beta chain; TCR, MHC, immu 97.49
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 97.49
2x1q_A127 Gelsolin nanobody; contractIle protein; 1.06A {Lam 97.48
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 97.48
2pnd_A119 V-SET and immunoglobulin domain containing 4; comp 97.47
4ei6_A208 Valpha1 XV19 type II natural killer T cell recept 97.47
1i3u_A127 Antibody VHH LAMA domain; VHH fragment, immune sys 97.46
2vsd_A105 CHIR AB1; immune system receptor, FC receptor; HET 97.46
1zxq_A192 ICAM-2, intercellular adhesion molecule-2; immunog 97.45
3cx5_J127 Heavy chain (VH) of FV-fragment; complex III, elec 97.44
2jjs_C127 Leukocyte surface antigen CD47; signal regulatory 97.44
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 97.43
1zvh_A134 Immunoglobulin heavy chain antibody variable domai 97.43
1mqk_H127 Antibody 7E2 FV fragment, heavy chain; membrane pr 97.42
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
Probab=99.47  E-value=6.4e-13  Score=92.94  Aligned_cols=97  Identities=18%  Similarity=0.264  Sum_probs=76.5

Q ss_pred             CCEEEEEcCCEEEEEEcccCCCCCeeEEEEEEcCCceeEEEEEEe--ccCCCceeecCCCCCCCCeEEEEEEeC---CCC
Q psy17207          7 ERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELS--GKPNPAIFRSHPQGRLPNSYNITWMVS---SYT   81 (123)
Q Consensus         7 ~R~~i~~~~~~~~L~I~~v~~~D~G~YtC~A~N~~G~~~~~i~l~--~~P~p~~~~~~~~~~~~~~~~L~w~~~---s~~   81 (123)
                      .|+.+...+..+.|.|.+++..|+|.|+|.|.|.+|.....+.|.  ..|.+|.....  .....++.|.|..+   ++.
T Consensus        65 ~~~~~~~~~~~~~L~i~~~~~~d~G~Y~C~a~n~~g~~~~~~~l~v~~~P~~p~~~~~--~~~~~~~~l~w~~p~~~~~~  142 (215)
T 3mtr_A           65 SNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQV--EPYSSTAQVQFDEPEATGGV  142 (215)
T ss_dssp             CSEEEEEETTEEEEEECCCSGGGCEEEEEEEECSSCEEEEEEEEEECCCCCCCEEEEE--EEETTEEEEEEECCSCCCSS
T ss_pred             ccEEEecCCCeeEEEEecCChhhCeEEEEEEEECCCceEEEEEEEECCCCCCCcceEE--EEecceEEEEEecCCccCCC
Confidence            678887767789999999999999999999999999998877665  46777655432  23467899999853   567


Q ss_pred             CCcceEEEeEEcCCCCCCceeeeecc
Q psy17207         82 PLEEFKIKYRKIPGNEPSPMSNQLTG  107 (123)
Q Consensus        82 pi~~y~v~yr~~~~~~~~w~~~~~~~  107 (123)
                      |+..|.|+|+....  ..|.......
T Consensus       143 pi~~y~v~~~~~~~--~~w~~~~~~~  166 (215)
T 3mtr_A          143 PILKYKAEWRAVGE--EVWHSKWYDA  166 (215)
T ss_dssp             CEEEEEEEEEETTC--CCCEEEEEEH
T ss_pred             ceEEEEEEEEECCC--Cccccccccc
Confidence            99999999998653  5788765443



>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>1zox_A CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, structural genomics, PSI, protein structure initiative; 2.10A {Mus musculus} Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Back     alignment and structure
>2qsq_A Carcinoembryonic antigen-related cell adhesion MO; glycoprotein, GPI-anchor, immunoglobulin DOMA lipoprotein, membrane; 1.95A {Homo sapiens} PDB: 2qst_A 2ver_N* 2gk2_A Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>2or8_A Hepatitis A virus cellular receptor 1 homolog; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 2.50A {Mus musculus} Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Back     alignment and structure
>1jhl_L IGG1-kappa D11.15 FV (light chain); complex(antibody-antigen); 2.40A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>1neu_A Myelin P0 protein; structural protein, glycoprotein, transmembrane, phosphorylation, immunoglobulin fold, signal; 1.90A {Rattus norvegicus} SCOP: b.1.1.1 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>3rrq_A Protein PD-1, programmed cell death protein 1; programmed death-1, costimulatory, immune system; 2.10A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>2q87_A CMRF35-H antigen; all-beta, immunoglobulin, IG-superfamily, IG-V, NKP44-like, natural killer cell IG-like receptor, inhibitory receptor; 1.70A {Homo sapiens} Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2or7_A T-cell immunoglobulin and mucin domain- containing protein 2; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 1.50A {Mus musculus} Back     alignment and structure
>2oyp_A Hepatitis A virus cellular receptor 2; TIM-3, T-cell immunoglobulin mucin, signaling protein; 1.95A {Mus musculus} PDB: 3kaa_A* Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2q20_A VK1 O18/O8 germline light chain variable domain; Al, light chain amyloidosis, amyloid, immunoglobulin, protein fibril; 1.30A {Homo sapiens} PDB: 2kqm_A 3cdf_A 3cdc_A 2kqn_A 3cdy_A 2q1e_A 3dvi_A 1igm_L 1bww_A 1b0w_A 1bre_A 1qp1_A 3dvf_A 1rei_A 1wtl_A 1ar2_A 1fgv_L 2bx5_A 2uzi_L* 1bvk_A ... Back     alignment and structure
>3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* Back     alignment and structure
>1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>1h5b_A Murine T cell receptor (TCR) valpha domain; immune response, immunoglobulin fold; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1h5b_C 1h5b_B Back     alignment and structure
>1i8k_A Epidermal growth factor receptor antibody MR1SCFV light chain; antibody-peptide complex, immunoglobulin fold, type II' beta turn., immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 PDB: 1i8i_A Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>3kg5_A B-cell antigen receptor complex-associated protei chain; CD79B, IG-beta, BCR, immunoglobulin domain, protein binding; 3.20A {Homo sapiens} Back     alignment and structure
>3sob_H Antibody heavy chain, low-density lipoprotein receptor-related protein; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_B 3uls_H 3ulu_D* 3ulv_D* Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>1j05_L T84.66 antibody, anti-CEA MAB T84.66, light chain; immunoglobulin, immune system; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1qfw_L* 1qnz_L 3iy3_A 3iy4_A Back     alignment and structure
>1ncn_A T lymphocyte activation antigen CD86; IG V, beta strands, immune system; 2.70A {Homo sapiens} SCOP: b.1.1.1 PDB: 1i85_A Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>1xt5_A Variable region-containing chitin-binding protein 3; innate immunity, VCBP, primordial antigen receptor, florida lancelet, amphioxus; 1.15A {Branchiostoma floridae} Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2e27_L Anti-ciguatoxin antibody, light chain; immunoglobulin fold, immune system; HET: AB0; 1.70A {Mus musculus} PDB: 3iy1_A Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>1qfw_M FV, antibody (anti beta subunit) (light chain); glycoprotein hormone; HET: NAG; 3.50A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>1mqk_L Antibody 7E2 FV fragment, light chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_D 3ehb_D* 3hb3_D* 1qle_L* 1f6l_L 3iy2_A 1vfa_A 1dvf_A 1kir_A 1g7i_A 1g7j_A 1a2y_A 1kip_A 1kiq_A 1vfb_A 1g7h_A 1a7o_L 1g7l_A 1g7m_A 1a7n_L ... Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>3mlr_H Human monoclonal anti-HIV-1 GP120 V3 antibody 255 heavy chain; human monoclonal antibody, FAB, third variable antibody-antigen interaction; 1.80A {Homo sapiens} PDB: 3mls_H 3mlt_H 3mlu_H 3mlv_H Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>3f8u_B Tapasin; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1eeq_A Kappa-4 immunoglobulin (light chain); protein stability, hydrogen bonds, immune system; 1.50A {Homo sapiens} SCOP: b.1.1.1 PDB: 1eeu_A 1lve_A 2lve_A 3lve_A 5lve_A 4lve_A 1efq_A 1qac_A 1ek3_A 2imm_A 1mvu_A 2ap2_A 1ap2_A 3bd3_A* 3bd4_A* 3bd5_A* 2imn_A 3dus_A* 3duu_A* 3dv4_A* ... Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>1kgc_D T-cell receptor alpha chain; LC13 clone, immune system; 1.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1mi5_D 3kpr_D 3kps_D 3o6f_C 3t0e_C 3pqy_D 2esv_D 3dxa_D 3dx9_A Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>2nms_A CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, inhibitory receptor, myelo-monocytic cells; 2.60A {Homo sapiens} Back     alignment and structure
>1pew_A JTO2, A lambda-6 type immunoglobulin light chain, domain; beta sheet, immune system; 1.60A {Homo sapiens} SCOP: b.1.1.1 PDB: 1cd0_A 1pw3_A 2cd0_A 2w0k_A 3b5g_A 3bdx_A* 2w0l_A Back     alignment and structure
>2qhl_A Novel immune-type receptor 10; immunoglobulin variable domain-like beta-sandwich, immune system; 1.56A {Ictalurus punctatus} PDB: 3b5t_A 2qjd_A 2qte_A 2qqq_A Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2h32_A Immunoglobulin IOTA chain; beta sheets, V and C-type IG folds, immune system; 2.70A {Homo sapiens} Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>1i3g_L Antibody FV fragment; antibiotic; 2.44A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy6_A Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1dlf_L Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 1.45A {Mus musculus} SCOP: b.1.1.1 PDB: 1wz1_L* 2dlf_L 1maj_A 1mak_A 1ktr_L 2cju_L* 2uud_K* 1dsf_L 3nn8_B 1n4x_L 1bfv_L* 1cfv_L* 2bfv_L* 1wt5_C Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>2bnu_A TCR alpha chain, T-cell receptor alpha chain C region; superagonist peptide T-cell vaccines, transmembrane, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2bnq_D 2bnr_D 2f54_D 2pyf_A* 2pye_D* 2f53_D 2p5e_D* 2p5w_D* 3mv7_D 3mv8_D 3mv9_D 3utt_D 2cdg_A Back     alignment and structure
>4ffy_L DENV1-E111 single chain variable fragment (light; viral envelope proteins, structural genomics, antibody epito flavivirus, niaid; 2.50A {Mus musculus} Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>4gjt_B Poliovirus receptor-related protein 4; six-bladed -propeller, IGV-like fold, viral entry, MV-H, NEC BETA4/BETA5 groove; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>2otu_A FV light chain variable domain; antibody FV polyglutamine complex, immune system; 1.68A {Mus musculus} PDB: 2otw_A 2gsg_A Back     alignment and structure
>1oaq_L Light chain; antibody, allergy, IGE, conformational diversity, multispecificity; 1.50A {Rattus rattus} SCOP: b.1.1.1 PDB: 1ocw_L 2bjm_L* 1oau_L* 1oar_L* 1oaz_L 1mfa_L* 1a6v_L* 1oax_L* 1oay_L* 1a6w_L* 1a6u_L 1dl7_L* Back     alignment and structure
>2ywz_A NEW antigen receptor variable domain; IG VNAR, immune system; 2.21A {Orectolobus maculatus} PDB: 2ywy_A Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>1tvd_A T cell receptor, ES204 V delta; immunoreceptor, TCR, delta chain, variable domain; 1.90A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>2ptt_A CD48 antigen; CD244, CD48, NK cell receptor, X-RAY, immune system; 1.63A {Mus musculus} PDB: 2ptv_A Back     alignment and structure
>2coq_A NEW antigen receptor variable domain; IG VNAR, natural TYPE2, immune system; 2.10A {Orectolobus maculatus} Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2frg_P TREM-like transcript-1; immunoglobulin-like, beta-sandwich, cell surface receptor, triggering receptor, platelet receptor, ITIM, immune system; 1.19A {Homo sapiens} Back     alignment and structure
>2ak4_D SB27 T cell receptor alpha chain; bulged epitopes, PMHC/TCR complex, immune system; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kxf_D 3nfj_I 3ffc_D Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2hp4_A T-cell surface glycoprotein CD8 alpha chain; CO-receptor, soluble protein, KD, protein engineering, immunotherapy, immune-suppressor, immune system; 2.10A {Homo sapiens} PDB: 1akj_D 1cd8_A 3qzw_G 2q3a_A Back     alignment and structure
>2eys_A NKT15; natural killer T cell receptor, immune system; 2.21A {Homo sapiens} PDB: 2eyr_A 2eyt_A 3huj_E* 3tyf_A 3tzv_A* 3sdx_E* 2po6_C* 2cde_A 3to4_C* Back     alignment and structure
>1nko_A Sialic acid binding IG-like lectin 7; immunoglobulin, siglec7, immune system; 1.45A {Homo sapiens} SCOP: b.1.1.1 PDB: 2g5r_A* 1o7v_A* 2df3_A* 1o7s_A* 2hrl_A* Back     alignment and structure
>2d9c_A Signal-regulatory protein beta-1; beta-sandwich, SIRP-beta-1, CD172B antigen, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>3bdb_A Novel immune-type receptor 11; immunoglobulin variable domain-like beta-sandwich, stalk region, immune system; 2.80A {Ictalurus punctatus} Back     alignment and structure
>2nw2_A ELS4 TCR alpha chain; T cell receptor, immune system; 1.40A {Homo sapiens} PDB: 2nx5_D 4dzb_A Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>3u1s_H FAB PGT145 heavy chain; IGG, broadly neutralizing antibody, HIV-1 GP120, immune SYST; HET: TYS; 2.30A {Homo sapiens} Back     alignment and structure
>3r0n_A Poliovirus receptor-related protein 2; IG-domain, cell-adhesion molecule, virus entry receptor, STR genomics, PSI-biology; 1.30A {Homo sapiens} PDB: 4dfh_A 4dfi_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1u9k_A Triggering receptor expressed on myeloid cells 1; activating receptors, TREM-1, innate immunity, immune system receptor, immune system; 1.76A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>1u3h_A T-cell receptor alpha-chain; complex, immune system; 2.42A {Mus musculus} SCOP: b.1.1.1 PDB: 1b88_A 1kj2_A* 1kb5_A 1d9k_A* Back     alignment and structure
>1lp9_E T-cell receptor alpha chain; immunoregulatory complex, class I MHC:TCR CO-crystal, immune; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 2j8u_E 2jcc_E 2uwe_E 1nfd_A* Back     alignment and structure
>1hxm_A Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2yc1_B Single chain antibody fragment 9004G; immune system-toxin complex, scorpion toxin; 1.90A {Homo sapiens} PDB: 2ybr_B 3lh2_L 3h3p_L 3lhp_L Back     alignment and structure
>1fo0_B Protein (BM3.3 T cell receptor beta-chain); class I MHC, H-2KB, TCR-PMHC complex, immune system; 2.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1nam_B* 2ol3_B* 1kb5_B 1kj2_B* Back     alignment and structure
>3bp6_A Programmed cell death protein 1; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3rnk_A 3sbw_A 3bp5_A 1npu_A 3rnq_A Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3t0v_A Immunoglobulin variable lambda domain; immunoglobulin fold, fluorogen activation, dimethylindole RE binding protein; HET: 1PE PE3; 1.45A {Homo sapiens} PDB: 3t0w_A* 3t0x_A* 3lrg_A 3lrh_A 2rhe_A Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>1sq2_N Novel antigen receptor; immunoglobulin fold, protein-protein complex, hydrolase/immune system complex; 1.45A {Ginglymostoma cirratum} SCOP: b.1.1.1 PDB: 1t6v_N Back     alignment and structure
>3u6r_L Antibody 1:7 (light chain); IG-like domain, neutralizing single chain FV, immune system; 2.67A {Homo sapiens} Back     alignment and structure
>1dlf_H Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 1.45A {Mus musculus} SCOP: b.1.1.1 PDB: 2dlf_H 1wz1_H* 3iy5_B 2uud_H* Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>1fo0_A Protein (BM3.3 T cell receptor alpha-chain); class I MHC, H-2KB, TCR-PMHC complex, immune system; 2.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1nam_A* Back     alignment and structure
>2atp_B T-cell surface glycoprotein CD8 beta chain; CD8AB, CD8AA, MHC, immune system; HET: NAG; 2.40A {Mus musculus} SCOP: b.1.1.1 PDB: 3b9k_B* Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>3rgv_A YAE62 TCR A chain; TCR, MHC, MHC class I, immune system; 2.90A {Mus musculus} PDB: 3c60_A Back     alignment and structure
>3moq_A NEW antigen receptor variable domain, P3(40) PEPT amyloid beta A4 protein; AB-ignar, AB-12Y-2, glycoprotein, membran protease inhibitor; 2.05A {Orectolobus maculatus} PDB: 2z8w_C 2z8v_C 1ves_A 1ver_A Back     alignment and structure
>1oga_D T-cell receptor alpha chain V region, beta-2-microglobulin; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2xna_A 2xn9_A 2vlm_D 2vlk_D 2vlj_D 2vlr_D 2cdf_A 2wbj_C* 3qdm_D 3qeq_D Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1p4b_L Antibody variable light chain; FV antibody, antigen peptide binder, SCFV, picomolar binder, immune system; 2.35A {Mus musculus} SCOP: b.1.1.1 PDB: 1p4i_L Back     alignment and structure
>3mbe_C I-AG7; T cell receptor, histocompatability antigen, MHC class II, I immune system; HET: NAG; 2.89A {Mus musculus} Back     alignment and structure
>3bj9_1 Immunoglobulin IOTA chain, immunoglobulin lambda- like polypeptide 1; immunoglobulin domain, beta sheet, polymorphism, immune system; 2.00A {Homo sapiens} PDB: 2h3n_A Back     alignment and structure
>1mfa_H IGG1-lambda Se155-4 FAB (heavy chain); immunoglobulin; HET: GLA MMA; 1.70A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy2_B Back     alignment and structure
>3bia_X T-cell immunoglobulin and mucin domain- containing protein 4; beta barrel, immunoglobulin fold, IGV domain, TIM, glycoprotein; HET: TLA; 2.20A {Mus musculus} PDB: 3bi9_X* 3bib_X* Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1sjv_A R9; camelids antibody, domain swapping, heavy chain antibody, AN; 1.94A {Lama glama} SCOP: b.1.1.1 Back     alignment and structure
>2yc1_A Single chain antibody fragment 9004G; immune system-toxin complex, scorpion toxin; 1.90A {Homo sapiens} PDB: 2ybr_A 1dql_H 3cfi_C Back     alignment and structure
>3b9v_A Heavy chain variable domain; antibody engineering, phage display, immune system; 1.80A {Homo sapiens} PDB: 1fvc_B 3p9w_B 1fgv_H 2vh5_H* Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>1kxv_C Camelid VHH domain CAB10; beta 8 alpha 8, beta barrel, hydrolase, immune system; 1.60A {Camelus dromedarius} SCOP: b.1.1.1 Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>3bik_B Programmed cell death protein 1; CO-stimulation, receptor-ligand complex, immunoglobulin-like sandwich, T cell, B cell, programmed death; 2.65A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>3c6l_A TCR 2W20 alpha chain; TCR-PMHC complex; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1n4x_H Immunoglobulin heavy chain variable region; immune system; 1.70A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy4_B Back     alignment and structure
>1a2y_B IGG1-kappa D1.3 FV (heavy chain); complex (immunoglobulin/hydrolase), immunoglobulin V region, signal, hydrolase, glycosidase, bacteriolytic enzyme, egg white; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1a7r_H 1dvf_B 1g7h_B 1g7i_B 1g7j_B 1g7l_B 1g7m_B 1kir_B 1vfa_B 1vfb_B 1kiq_B 1a7o_H 1a7n_H 1a7p_H 1kip_B 1a7q_H 1dl7_H* 1bvk_B 1bvl_A 1p4i_H ... Back     alignment and structure
>1j05_H T84.66 antibody, anti-CEA MAB T84.66, heavy chain; immunoglobulin, immune system; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1dvf_D 1mvu_B 1ap2_B 2ap2_B Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>1hkf_A NKP44, NK cell activating receptor; natural cytotoxicity receptor, immunoglobulin domain; 2.2A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2wzp_D Camelid VHH5; baseplate, viral protein; 2.60A {Lama glama} PDB: 2bse_D Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2q86_A Valpha14 TCR; INKT cells, TCR, glycolipid recognition, innate immunity, IM system; HET: NAG BMA MAN FUC; 1.85A {Mus musculus} PDB: 3quy_C* 3o9w_C* 3qux_C* 3o8x_C* 3quz_C* 3rtq_C* 3rzc_C* 3ta3_C* 3tvm_C* 3qi9_C* 3ard_C* 3are_C* 3arf_C* 3arg_C* 3he6_C* 3he7_C* 3arb_C* 3scm_C* 3sda_C* 3sdc_C* ... Back     alignment and structure
>1xiw_D Immunoglobulin heavy chain variable region; CD3-epsilon, CD3-delta, UCHT1-SCFV, immunoglobulin fold, antibody-antigen complex; 1.90A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy3_B Back     alignment and structure
>3gsn_A RA14 TCR alpha chain (TRAV24, TRAJ49); HLA, human cytomegalovirus, PP65, T cell receptor (TCR), immune response, public response; 2.80A {Homo sapiens} Back     alignment and structure
>1kxt_B Immunoglobulin VHH fragment; alpha 8 beta 8, beta barrel, hydrolase, immune system; 2.00A {Camelus dromedarius} SCOP: b.1.1.1 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3tjh_C 42F3 alpha; IG MHC, antigen recognition, TCR-PMHC, membrane receptor, IM system; 2.12A {Mus musculus} PDB: 3tpu_A 3tfk_C 1j8h_D* 1fyt_D* 4gkz_A* 3rev_A 1mwa_A* 1g6r_A* 1tcr_A* 2ckb_A 1zgl_M 3c5z_A 1i9e_A* 2oi9_B 2e7l_A 2icw_I 3e2h_B 3e3q_D 4h1l_G Back     alignment and structure
>2p45_B Antibody CAB-RN05; seMet phasing, camelid single-domain antibody, VHH, RNAse A, yeast surface display, hydrolase/immune system complex; 1.10A {Camelus dromedarius} PDB: 2p46_B 2p47_B 2p48_B 2p44_B 2p49_B 2p42_B 2p43_B 1bzq_K 3qsk_B 2p4a_B 1op9_A 1sjx_A 3qxt_A* 3qxu_A 3eba_A Back     alignment and structure
>1yc7_A Anti-VSG immunoglobulin heavy chain variable domain caban33; antibody, camel antibody, immune system; 1.60A {Camelus dromedarius} PDB: 1yc8_A 1yzz_A Back     alignment and structure
>1xau_A B- and T-lymphocyte attenuator; IG domain, beta sandwich, structural genomics, PSI, protein structure initiative; 1.80A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>2oi9_C V beta, T cell receptor beta chain; TCR, MHC, immune system; 2.35A {Mus musculus} PDB: 2e7l_C Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2x1q_A Gelsolin nanobody; contractIle protein; 1.06A {Lama glama} PDB: 2x1p_A 2xa3_A 3k7u_A 3sn6_N* 3stb_A 2x1o_A 3k80_A 1ol0_A 1u0q_A 1qd0_A* 3ezj_B 3p0g_B* 1mvf_A 1t2j_A Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2pnd_A V-SET and immunoglobulin domain containing 4; complement receptor, IG-like domain, immune system; 1.00A {Mus musculus} PDB: 2icc_A 2ice_S* 2icf_S* Back     alignment and structure
>4ei6_A Valpha1 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_C 4elk_A 4elm_E* 3qeu_A 1ao7_D 3qdj_D 3qdg_D 3qfj_D 1qsf_D 1qse_D* 3d39_D* 3d3v_D* 3h9s_D 3pwp_D 2gj6_D 3utp_D* 3uts_D 1qrn_D 3hg1_D 3rdt_A ... Back     alignment and structure
>1i3u_A Antibody VHH LAMA domain; VHH fragment, immune system; HET: RR1; 1.95A {Lama glama} SCOP: b.1.1.1 PDB: 1i3v_A Back     alignment and structure
>2vsd_A CHIR AB1; immune system receptor, FC receptor; HET: NAG NDG MAN; 1.82A {Gallus gallus} Back     alignment and structure
>1zxq_A ICAM-2, intercellular adhesion molecule-2; immunoglobulin fold, cell adhesion, glycoprotein, transmembr; HET: NAG; 2.20A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>3cx5_J Heavy chain (VH) of FV-fragment; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Mus musculus} SCOP: b.1.1.1 PDB: 1kb9_J* 1kyo_J* 1p84_J* 2ibz_X* 1ezv_X* 3cxh_J* Back     alignment and structure
>2jjs_C Leukocyte surface antigen CD47; signal regulatory protein alpha, immunoglobulin superfamily, transmembrane, phosphoprotein, paired receptor; HET: NAG; 1.85A {Homo sapiens} PDB: 2jjt_C* 2vsc_A* Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1zvh_A Immunoglobulin heavy chain antibody variable domain; beta sandwich, immunoglobulin fold, protein-protein heterocomplex; 1.50A {Camelus dromedarius} SCOP: b.1.1.1 PDB: 3dwt_A 1g6v_K 1zv5_A 1kxq_E Back     alignment and structure
>1mqk_H Antibody 7E2 FV fragment, heavy chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_C 3ehb_C* 3hb3_C* 1qle_H* 2otu_B 2gsg_B 2otw_B 1qfw_I* 3ab0_B 1i8k_B 1i8i_B 1vhp_A 1bfv_H* 1cfv_H* 2bfv_H* 1dsf_H Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 123
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 5e-08
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 6e-07
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 1e-05
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 2e-05
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 4e-05
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 4e-05
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 5e-05
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 5e-05
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 6e-05
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 2e-04
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 3e-04
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 3e-04
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 4e-04
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 4e-04
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 7e-04
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 8e-04
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 9e-04
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 0.001
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 0.001
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 0.002
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 0.002
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 0.002
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 0.004
d1iama1103 b.1.1.3 (A:83-185) Intercellular cell adhesion mol 0.004
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Cardiac myosin binding protein C, different domains
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 45.8 bits (107), Expect = 5e-08
 Identities = 13/51 (25%), Positives = 21/51 (41%)

Query: 1   MRLETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLELS 51
           +  ET  R  +ET   R    +      D G Y+    NP+G+ +  L + 
Sbjct: 77  LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVK 127


>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1gxea_130 Cardiac myosin binding protein C, different domain 99.2
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.17
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.16
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.12
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.09
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.08
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.04
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.04
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 98.98
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 98.97
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.92
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 98.88
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 98.86
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.84
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 98.81
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 98.79
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.79
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 98.78
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.77
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 98.76
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 98.75
d2avga1110 Cardiac myosin binding protein C, different domain 98.75
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 98.74
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 98.72
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 98.71
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.7
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 98.69
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 98.65
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 98.64
d1pd6a_94 Cardiac myosin binding protein C, different domain 98.63
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.62
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.61
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.56
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.56
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.55
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 98.53
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 98.48
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 98.45
d2ifga192 High affinity nerve growth factor receptor TrkA, d 98.43
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.42
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 98.42
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.37
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 98.37
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 98.36
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 98.35
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.35
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 98.33
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.33
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 98.3
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 98.26
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 98.23
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.21
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.17
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.09
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 97.98
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.94
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 97.94
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 97.94
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 97.91
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.88
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 97.87
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 97.56
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 97.56
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 97.46
d2crza197 Fibronectin type-III domain containing protein 3a, 97.43
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 97.39
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 97.34
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 97.32
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 97.31
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 97.31
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 97.3
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 97.3
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 97.29
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 97.29
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 97.28
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 97.22
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 97.18
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 97.17
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.14
d1ospl1107 Immunoglobulin light chain kappa variable domain, 97.14
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 97.13
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 97.12
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 97.11
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 97.11
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 97.11
d1oaql_110 Immunoglobulin light chain lambda variable domain, 97.1
d1d5il1107 Immunoglobulin light chain kappa variable domain, 97.09
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 97.09
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 97.08
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 97.07
d1lgva1112 Immunoglobulin light chain lambda variable domain, 97.07
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 97.06
d1op3k1106 Immunoglobulin light chain kappa variable domain, 97.04
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 97.03
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 97.02
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 97.01
d2gsia1111 Immunoglobulin light chain kappa variable domain, 97.01
d1mexl1107 Immunoglobulin light chain kappa variable domain, 97.0
d1j05a_111 Immunoglobulin light chain kappa variable domain, 96.97
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 96.96
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 96.93
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 96.91
d8faba1103 Immunoglobulin light chain lambda variable domain, 96.9
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 96.9
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 96.89
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 96.88
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 96.88
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.87
d1nfde1108 Immunoglobulin light chain lambda variable domain, 96.87
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 96.86
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 96.84
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 96.82
d1jhll_108 Immunoglobulin light chain kappa variable domain, 96.82
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 96.81
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 96.81
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 96.8
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 96.8
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 96.79
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 96.79
d2rhea_114 Immunoglobulin light chain lambda variable domain, 96.79
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 96.7
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 96.69
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 96.65
d1w72l1109 Immunoglobulin light chain lambda variable domain, 96.64
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 96.61
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 96.57
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 96.56
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 96.56
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 96.54
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 96.52
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.52
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 96.52
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 96.52
d1mjul1112 Immunoglobulin light chain kappa variable domain, 96.49
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 96.48
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 96.46
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 96.44
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 96.43
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 96.4
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 96.38
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 96.38
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 96.36
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.35
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 96.33
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 96.33
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 96.29
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 96.29
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 96.28
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 96.27
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 96.27
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 96.26
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.11
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 96.09
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 96.08
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 96.06
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 96.06
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 96.04
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 96.0
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 95.99
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 95.86
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 95.85
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 95.8
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 95.79
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 95.78
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 95.78
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 95.75
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 95.73
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 95.72
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 95.7
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 95.65
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 95.65
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 95.62
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 95.61
d2crma1107 Fibronectin type-III domain containing protein 3a, 95.6
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 95.53
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 95.52
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 95.5
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 95.48
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 95.46
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 95.46
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 95.29
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 95.28
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 95.27
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 95.27
d1x4xa193 Fibronectin type-III domain containing protein 3a, 95.25
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 95.22
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 95.2
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 95.16
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 95.16
d1va9a1109 Down syndrome cell adhesion molecule-like protein 95.14
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 95.06
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 95.06
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 95.03
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 95.0
d1hnfa1101 CD2, first domain {Human (Homo sapiens) [TaxId: 96 94.96
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 94.94
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 94.91
d1rz7h1119 Immunoglobulin heavy chain variable domain, VH {Hu 94.84
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 94.84
d2nxyd1128 Immunoglobulin heavy chain variable domain, VH {Hu 94.83
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 94.83
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 94.82
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 94.78
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 94.78
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 94.75
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 94.75
d1i3ua_127 Camelid IG heavy chain variable domain, VHh {Llama 94.71
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 94.67
d1dlfh_120 Immunoglobulin heavy chain variable domain, VH {Mo 94.57
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 94.51
d1x3da1105 Fibronectin type-III domain containing protein 3a, 94.51
d2p49b1121 Camelid IG heavy chain variable domain, VHh {Camel 94.51
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 94.49
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 94.47
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 94.47
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 94.46
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 94.44
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 94.42
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 94.42
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 94.35
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 94.34
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 94.31
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 94.26
d1op3h1125 Immunoglobulin heavy chain variable domain, VH {En 94.25
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 94.25
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 94.23
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 94.21
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 94.2
d2fb4h1127 Immunoglobulin heavy chain variable domain, VH {Hu 94.17
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 94.15
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 94.08
d1fltx_95 Second domain of the Flt-1 receptor {Human (Homo s 94.03
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 94.03
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 93.99
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 93.97
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 93.96
d3c2ah1131 Immunoglobulin heavy chain variable domain, VH {Hu 93.96
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 93.95
d1lmka1126 Immunoglobulin heavy chain variable domain, VH {Mo 93.9
d1ad9b1120 Immunoglobulin heavy chain variable domain, VH {En 93.84
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 93.78
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 93.74
d1rzga1130 Immunoglobulin heavy chain variable domain, VH {Hu 93.71
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 93.68
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 93.65
d1q9rb1122 Immunoglobulin heavy chain variable domain, VH {Mo 93.64
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 93.61
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 93.61
d1rzfh1133 Immunoglobulin heavy chain variable domain, VH {Hu 93.59
d1b2wh1117 Immunoglobulin heavy chain variable domain, VH {En 93.56
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 93.54
d2fx7h1127 Immunoglobulin heavy chain variable domain, VH {Hu 93.48
d1yedb1124 Immunoglobulin heavy chain variable domain, VH {Mo 93.47
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 93.47
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 93.44
d1nfdf1121 Immunoglobulin heavy chain variable domain, VH {Ha 93.43
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 93.38
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 93.36
d1rhhb1130 Immunoglobulin heavy chain variable domain, VH {Hu 93.35
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 93.35
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 93.31
d1n0xh1127 Immunoglobulin heavy chain variable domain, VH {Hu 93.28
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 93.25
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 93.16
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 93.03
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 92.94
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 92.84
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 92.75
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 92.62
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 92.61
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 92.57
d1fn4b1116 Immunoglobulin heavy chain variable domain, VH {Ra 92.4
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 92.37
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 92.35
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 92.21
d3cx5j1127 Immunoglobulin heavy chain variable domain, VH {Mo 92.18
d2b1hh1124 Immunoglobulin heavy chain variable domain, VH {En 92.16
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 92.07
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 92.06
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 92.06
d1lo4h1118 Immunoglobulin heavy chain variable domain, VH {Mo 92.05
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 91.7
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 91.52
d1x5xa196 Fibronectin type-III domain containing protein 3a, 91.08
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 90.93
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 90.18
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 90.1
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 90.1
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 89.84
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 89.42
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 89.4
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 89.27
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 88.95
d2dtge2 196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 88.68
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 88.11
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 87.62
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 87.44
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 87.28
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 85.57
d3d85d187 The p40 domain of interleukin-12 (IL-12 beta chain 81.13
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Telokin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.36  E-value=1.5e-12  Score=81.13  Aligned_cols=59  Identities=22%  Similarity=0.337  Sum_probs=50.4

Q ss_pred             CccccCCCEEEEEcCCEEEEEEcccCCCCCeeEEEEEEcCCceeEEEEEE--eccCCCcee
Q psy17207          1 MRLETTERRIMETRGSRHTLMIRKVVASDFGNYSCEATNPMGKHRAYLEL--SGKPNPAIF   59 (123)
Q Consensus         1 ~~l~~d~R~~i~~~~~~~~L~I~~v~~~D~G~YtC~A~N~~G~~~~~i~l--~~~P~p~~~   59 (123)
                      ++|..++|+.+...+..+.|.|.+++.+|+|.|+|.|+|.+|.+..++.|  .+.|.||.+
T Consensus        39 ~~l~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~a~N~~G~~~~~~~l~V~~~P~pP~g   99 (101)
T d2cqva1          39 KQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAG   99 (101)
T ss_dssp             SBCCCSSSEEEEECSSEEEEEETTCCTTTCEEEEEEEECSSCEEECCEEEEEECSCSCCCC
T ss_pred             eeeccCCcEEEEEecceeEEEEeeCCcccCEEEEEEEEECCCEEEEEEEEEEEecCCCcCC
Confidence            35778899999888888999999999999999999999999999986555  457777643



>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d3c2ah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1b2wh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin heavy chain variable domain, VH {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fn4b1 b.1.1.1 (B:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d3d85d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure