Diaphorina citri psyllid: psy17212


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MGNCYKRELSQTSVIIGLGHGKTHKDAASVRATHPIPPSCGLYYFEVKIVSKGRDGYMGIGLSAQDVNMNRLPGKYLSCGLYFEVKIVSKGWDGYMGIGMSA
cccccEEEEcccccEEEEccccccccCEEEEcccccccccccEEEEEEEEEcccccEEEEEccccccccccccccccccCEEEEEEEEECcccccCCccccc
****YKR*LSQTSVIIGLG**KTHKDAASVRATHPIPPSCGLYYFEVKIVSKGRDGYMGIGLSAQDVNMNRLPGKYLSCGLYFEVKIVSKGWDGYMGIG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNCYKRELSQTSVIIGLGHGKTHKDAASVRATHPIPPSCGLYYFEVKIVSKGRDGYMGIGLSAQDVNMNRLPGKYLSCGLYFEVKIVSKGWDGYMGIGMSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ran-binding protein 10 Acts as a guanine nucleotide exchange factor (GEF) for RAN GTPase (By similarity). May play an essential role in hemostasis and in maintaining microtubule dynamics with respect to both platelet shape and function (By similarity). May act as an adapter protein to couple membrane receptors to intracellular signaling pathways. Enhances dihydrotestosterone-induced transactivation activity of AR, as well as dexamethasone-induced transactivation activity of NR3C1, but does not affect estrogen-induced transactivation. In contrast to RANBP9, does not interact with Sos and does not activate the Ras pathway.very confidentQ6VN20
Ran-binding protein 10 May act as an adapter protein to couple membrane receptors to intracellular signaling pathways (By similarity). Enhances dihydrotestosterone-induced transactivation activity of AR, as well as dexamethasone-induced transactivation activity of NR3C1, but does not affect estrogen-induced transactivation (By similarity). Acts as a guanine nucleotide exchange factor (GEF) for RAN GTPase. May play an essential role in hemostasis and in maintaining microtubule dynamics with respect to both platelet shape and function.very confidentQ6VN19
Ran-binding protein 10 May act as an adapter protein to couple membrane receptors to intracellular signaling pathways.very confidentQ1LUS8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0005087 [MF]Ran guanyl-nucleotide exchange factor activityprobableGO:0005088, GO:0005083, GO:0005085, GO:0030695, GO:0003674, GO:0060589, GO:0030234
GO:0048487 [MF]beta-tubulin bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0008536 [MF]Ran GTPase bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0006461 [BP]protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0000226 [BP]microtubule cytoskeleton organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YYO, chain A
Confidence level:very confident
Coverage over the Query: 4-101
View the alignment between query and template
View the model in PyMOL