Diaphorina citri psyllid: psy17213

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------7
METADVCIGTSVGTITEPECLGPCEPGTSVTLEGIVWHETEGTSVTLEGIVWHETEGKGISQSLFILLN
cccEEEEEECcEEEEcccccccccccccEEEEEEEEEEEcccCEEEEEEEEEECcccccCEEEEEEEEc
*****VCIGTSVGTITEPECLGPCEPGTSVTLEGIVWHETEGTSVTLEGIVWHETEGKGISQSLFILLN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METADVCIGTSVGTITEPECLGPCEPGTSVTLEGIVWHETEGTSVTLEGIVWHETEGKGISQSLFILLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein 608 confidentQ56A10
Zinc finger protein 608 confidentQ9ULD9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0045879 [BP]negative regulation of smoothened signaling pathwayprobableGO:0008589, GO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0007412 [BP]axon target recognitionprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0007154, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0048190 [BP]wing disc dorsal/ventral pattern formationprobableGO:0032502, GO:0007389, GO:0032501, GO:0009953, GO:0044707, GO:0007444, GO:0007450, GO:0048856, GO:0035222, GO:0035220, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007447, GO:0007275, GO:0044699
GO:0045570 [BP]regulation of imaginal disc growthprobableGO:0048638, GO:0046620, GO:0040008, GO:0008150, GO:0050793, GO:2000026, GO:0051239, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted