Diaphorina citri psyllid: psy17215


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
LHFCEGQSYGKKFELTYISLSFCPKSIKPDSLAIYKSQDFGKSWQPLQFYSSQCKKLYGRTATGVISRGNEQEALCTDRHKKQGKGKMSRRRTNCQEVKVNSVCGLESPERYCDTSGACHVCDAGSPRGRFPAEYLTDLNNPSNVTCWRSEAQTSVNSLSASPDNVTLTLSLEK
cCEEEEECcccEEEEEEEEEEEcccccccccEEEEEEcccccccEEEEEEHHHcHHHcccccccccccccccccECcccccccccccccccEEEEEEEEECcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccCEEEEEEccc
LHFCEGQSYGKKFELTYISLSFCPKSIKPDSLAIYKSQDFGKSWQPLQFYSSQCKKLYGRTATGVIS******ALCT*R**********RRRTNCQEVKVNSVCGLESPERYCDTSGACHVCDAGSPRGRFPAEYLTDLNNPSNVTCWRSEAQTSVNSLSASPDNVTLTLSLE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LHFCEGQSYGKKFELTYISLSFCPKSIKPDSLAIYKSQDFGKSWQPLQFYSSQCKKLYGRTATGVISRGNEQEALCTDRHKKQGKGKMSRRRTNCQEVKVNSVCGLESPERYCDTSGACHVCDAGSPRGRFPAEYLTDLNNPSNVTCWRSEAQTSVNSLSASPDNVTLTLSLEK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Netrin-1 Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. It also serve as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in colorectal tumorigenesis by regulating apoptosis.confidentQ924Z9
Netrin unc-6 Component of an extracellular matrix cue that guides dorsoventral migrations on the epidermis. Required for the guidance of pioneer axons and migrating cells along the body wall. Its association with either unc-40 or unc-5 receptors will lead to axon attraction or repulsion, respectively.confidentP34710
Netrin-1 Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. It also serve as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in colorectal tumorigenesis by regulating apoptosis.confidentQ2HXW4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016358 [BP]dendrite developmentprobableGO:0048666, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0032502, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0048598 [BP]embryonic morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0033564 [BP]anterior/posterior axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0040012 [BP]regulation of locomotionprobableGO:0008150, GO:0065007, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0008045 [BP]motor neuron axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0040023 [BP]establishment of nucleus localizationprobableGO:0051234, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0051649, GO:0051647, GO:0051656, GO:0051179, GO:0051640, GO:0051641
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0048646 [BP]anatomical structure formation involved in morphogenesisprobableGO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0048732 [BP]gland developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0060562 [BP]epithelial tube morphogenesisprobableGO:0032502, GO:0002009, GO:0048856, GO:0035239, GO:0044707, GO:0060429, GO:0009888, GO:0044767, GO:0032501, GO:0008150, GO:0048729, GO:0035295, GO:0009653, GO:0007275, GO:0044699
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030517 [BP]negative regulation of axon extensionprobableGO:0022604, GO:0048638, GO:0044707, GO:0045926, GO:0051239, GO:0030308, GO:0022603, GO:0030154, GO:0051129, GO:0051128, GO:0060284, GO:0061387, GO:0031345, GO:0031344, GO:0044699, GO:0016043, GO:0050767, GO:0048869, GO:0040008, GO:0050768, GO:0050789, GO:0045664, GO:0010769, GO:0065007, GO:0071840, GO:0010721, GO:0048640, GO:0048519, GO:0065008, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0008361, GO:0001558, GO:0044763, GO:0090066, GO:0010975, GO:0048731, GO:0030516, GO:0022008, GO:0051093, GO:0048699, GO:0050771, GO:0050770, GO:0007399, GO:0048856, GO:0045595, GO:0051960, GO:2000026, GO:0032535, GO:0007275, GO:0008150, GO:0048523
GO:0045773 [BP]positive regulation of axon extensionprobableGO:0048639, GO:0048638, GO:0048856, GO:0045927, GO:0022603, GO:0030307, GO:0030154, GO:0051128, GO:0016043, GO:0061387, GO:0031344, GO:0044699, GO:0031346, GO:0050767, GO:0048869, GO:0040008, GO:0060284, GO:0050769, GO:0045664, GO:0010769, GO:0065007, GO:0071840, GO:0010720, GO:0048518, GO:0065008, GO:0051130, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0008361, GO:0001558, GO:0044763, GO:0090066, GO:0010975, GO:0048731, GO:0030516, GO:0022008, GO:0051239, GO:0044707, GO:0048699, GO:0050770, GO:0007399, GO:0050772, GO:0022604, GO:0051094, GO:0045595, GO:0050789, GO:0051960, GO:2000026, GO:0007275, GO:0008150, GO:0032502, GO:0032535, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AQT, chain A
Confidence level:very confident
Coverage over the Query: 69-174
View the alignment between query and template
View the model in PyMOL
Template: 4AQT, chain A
Confidence level:very confident
Coverage over the Query: 2-84
View the alignment between query and template
View the model in PyMOL