Diaphorina citri psyllid: psy17227


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
TPSRGLLRHIIQQTYNQSVTEPEKLNVYQPFSPFVYGETSFDLISRMIDQINATPDDVFVDLGSGVGQVVLQVAAATGCKICWGVEKADLPAKYAEMHTVFKRWMQWYGKRHGEFRLVKGDFLTEEHREKITQASIVFVNNFAFGPTVDHALKERFQDLKDGARIVSSKSFCPLNFRITDRNLTDGGKKVPPGRGCVDQTLTSLSTATALPVSELHTELEIPPTPAETPYSLQMLLDILRNQYLAMIERLKSEKYKKEVEDQIEIEKN
cccHHHHHHHHHHHHHcccccHHHHcccccccccEEECccHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHcccEEEEEECcccHHHHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHccccEEEEEEcccccHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccccCEEEECcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHc
***RGLLRHIIQQTYNQSVTEPEKLNVYQPFSPFVYGETSFDLISRMIDQINATPDDVFVDLGSGVGQVVLQVAAATGCKICWGVEKADLPAKYAEMHTVFKRWMQWYGKRHGEFRLVKGDFLTEEHREKITQASIVFVNNFAFGPTVDHALKERFQDLKDGARIVSSKSFCPLNFRITDRNLTDGGKKVPPGRGCVDQTLTSLSTATALPVSELHTELEIPPTPAETPYSLQMLLDILRNQYLAMIERL******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TPSRGLLRHIIQQTYNQSVTEPEKLNVYQPFSPFVYGETSFDLISRMIDQINATPDDVFVDLGSGVGQVVLQVAAATGCKICWGVEKADLPAKYAEMHTVFKRWMQWYGKRHGEFRLVKGDFLTEEHREKITQASIVFVNNFAFGPTVDHALKERFQDLKDGARIVSSKSFCPLNFRITDRNLTDGGKKVPPGRGCVDQTLTSLSTATALPVSELHTELEIPPTPAETPYSLQMLLDILRNQYLAMIERLKSEKYKKEVEDQIEIEKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone-lysine N-methyltransferase, H3 lysine-79 specific Histone methyltransferase. Methylates 'Lys-79' of histone H3. Nucleosomes are preferred as substrate compared to free histones. Binds to DNA.confidentQ8TEK3
Histone-lysine N-methyltransferase, H3 lysine-79 specific Histone methyltransferase. Methylates 'Lys-79' of histone H3. Required for Polycomb Group (PcG) and trithorax Group (trxG) maintenance of expression. Also involved in telomeric silencing but do not in centric heterochromatin. Probably participates in pairing sensitivity.confidentQ8INR6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0018024 [MF]histone-lysine N-methyltransferase activityprobableGO:0042054, GO:0003824, GO:0008757, GO:0016740, GO:0016278, GO:0016279, GO:0016741, GO:0008170, GO:0008276, GO:0003674, GO:0008168
GO:0046425 [BP]regulation of JAK-STAT cascadeprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789
GO:0034968 [BP]histone lysine methylationprobableGO:0006479, GO:0008213, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016571, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044763, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UWP, chain A
Confidence level:very confident
Coverage over the Query: 2-190
View the alignment between query and template
View the model in PyMOL