Diaphorina citri psyllid: psy17244

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MNKVYIAQHQAVKYEIFPLSPLSRHRLSIVKRKVLVLDLDETLIHSHHDGITRPTVKPGTPPDFVLKVTIDRHPVRFFVHKRPHVDFFLDIVSQWYELVVFTASMEIYGAAVADKLDARRHILRRRYYRQHCTPELGSYTKDLSAISPDLSSIFILDNSPGAYRGFPDNAIPIKSWFSDPSDTALLALLPVLDALR
ccHHHHHHHcccccccccccccccccccccccEEEEEEccccEEcccccccccccccccccccEEEEEEEccEEEEEEEEEcccHHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccccEEEEEccccccccccccCEECccccccccccEEEEEccccccccccccCEEccccccccccHHHHHHHHHHHHcc
**KVYIAQHQAVKYEIFPLSPLSRHRLSIVKRKVLVLDLDETLIHSHHDGITRPTVKPGTPPDFVLKVTIDRHPVRFFVHKRPHVDFFLDIVSQWYELVVFTASMEIYGAAVADKLDARRHILRRRYYRQHCTPELGSYTKDLSAISPDLSSIFILDNSPGAYRGFPDNAIPIKSWFSDPSDTALLALLPVLDALR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKVYIAQHQAVKYEIFPLSPLSRHRLSIVKRKVLVLDLDETLIHSHHDGITRPTVKPGTPPDFVLKVTIDRHPVRFFVHKRPHVDFFLDIVSQWYELVVFTASMEIYGAAVADKLDARRHILRRRYYRQHCTPELGSYTKDLSAISPDLSSIFILDNSPGAYRGFPDNAIPIKSWFSDPSDTALLALLPVLDALR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CTD nuclear envelope phosphatase 1 Serine/threonine protein phosphatase forming with CNEP1R1 an active phosphatase complex that dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol. May antagonize BMP signaling.very confidentQ3TP92
CTD nuclear envelope phosphatase 1 Serine/threonine protein phosphatase forming with CNEP1R1 an active phosphatase complex that dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol. May antagonize BMP signaling.very confidentQ3B7T6
CTD nuclear envelope phosphatase 1B Serine/threonine protein phosphatase that may dephosphorylate and activate lipins. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol. May antagonize BMP signaling.very confidentQ5U3T3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016791 [MF]phosphatase activityconfidentGO:0042578, GO:0016787, GO:0003674, GO:0016788, GO:0003824
GO:0006998 [BP]nuclear envelope organizationconfidentGO:0006996, GO:0006997, GO:0016044, GO:0009987, GO:0016043, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0006470 [BP]protein dephosphorylationconfidentGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005789 [CC]endoplasmic reticulum membraneconfidentGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0034504 [BP]protein localization to nucleusconfidentGO:0008104, GO:0070727, GO:0034613, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0031965 [CC]nuclear membraneconfidentGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0071595 [CC]Nem1-Spo7 phosphatase complexconfidentGO:0043234, GO:0008287, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0042175, GO:0012505, GO:0044425
GO:0010867 [BP]positive regulation of triglyceride biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031323, GO:0046890, GO:0050789, GO:0090208, GO:0031328, GO:0065007, GO:0048518, GO:0045834, GO:0010866, GO:0090207, GO:0019216, GO:0009889, GO:0050794, GO:0008150, GO:0046889, GO:0080090, GO:0048522
GO:0007474 [BP]imaginal disc-derived wing vein specificationprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0003002, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0051783 [BP]regulation of nuclear divisionprobableGO:0033043, GO:0051128, GO:0008150, GO:0065007, GO:0050794, GO:0050789
GO:0045665 [BP]negative regulation of neuron differentiationprobableGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008420 [MF]CTD phosphatase activityprobableGO:0016787, GO:0016791, GO:0004722, GO:0004721, GO:0042578, GO:0003824, GO:0003674, GO:0016788

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HHL, chain A
Confidence level:very confident
Coverage over the Query: 29-196
View the alignment between query and template
View the model in PyMOL