Diaphorina citri psyllid: psy17247


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40-
MSKTVFGLYLGNSSASIGICRDGKVEILANEAGDRVTPAVV
cccEEEEEEccccCEEEEEEEccCEEEEEcccccCCccccc
**KTVFGLYLGNSSASIGICRDGKVEILANEAGDRVTPA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKTVFGLYLGNSSASIGICRDGKVEILANEAGDRVTPAVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heat shock 70 kDa protein 14 Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity.confidentQ5RE21
Heat shock 70 kDa protein 14 Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity.confidentQ2YDD0
Heat shock 70 kDa protein 14 Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity.confidentQ6AYB4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005788 [CC]endoplasmic reticulum lumenprobableGO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0005488 [MF]bindingprobableGO:0003674
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044267 [BP]cellular protein metabolic processprobableGO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0005840 [CC]ribosomeprobableGO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D2F, chain A
Confidence level:very confident
Coverage over the Query: 2-41
View the alignment between query and template
View the model in PyMOL