Psyllid ID: psy17247
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 41 | ||||||
| 328713346 | 497 | PREDICTED: heat shock 70 kDa protein 14- | 1.0 | 0.082 | 0.651 | 3e-06 | |
| 321464824 | 501 | hypothetical protein DAPPUDRAFT_306599 [ | 0.878 | 0.071 | 0.5 | 9e-05 | |
| 410918436 | 506 | PREDICTED: heat shock 70 kDa protein 14- | 0.926 | 0.075 | 0.552 | 0.0001 | |
| 242002186 | 375 | HSP70, putative [Ixodes scapularis] gi|2 | 0.878 | 0.096 | 0.583 | 0.0002 | |
| 213403980 | 546 | heat shock protein [Schizosaccharomyces | 0.926 | 0.069 | 0.578 | 0.0003 | |
| 196015813 | 510 | hypothetical protein TRIADDRAFT_61844 [T | 0.926 | 0.074 | 0.5 | 0.0004 | |
| 391325523 | 500 | PREDICTED: heat shock 70 kDa protein 14- | 0.951 | 0.078 | 0.487 | 0.0007 |
| >gi|328713346|ref|XP_001945768.2| PREDICTED: heat shock 70 kDa protein 14-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 56.2 bits (134), Expect = 3e-06, Method: Composition-based stats.
Identities = 28/43 (65%), Positives = 39/43 (90%), Gaps = 2/43 (4%)
Query: 1 MSKT-VFGLYLGNSSASIGICRD-GKVEILANEAGDRVTPAVV 41
MS++ VFG+++GNS+ASI I ++ GKV++LANEAGDR+TPAVV
Sbjct: 1 MSRSIVFGIHVGNSTASIAISKEEGKVDVLANEAGDRITPAVV 43
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321464824|gb|EFX75829.1| hypothetical protein DAPPUDRAFT_306599 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|410918436|ref|XP_003972691.1| PREDICTED: heat shock 70 kDa protein 14-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|242002186|ref|XP_002435736.1| HSP70, putative [Ixodes scapularis] gi|215499072|gb|EEC08566.1| HSP70, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|213403980|ref|XP_002172762.1| heat shock protein [Schizosaccharomyces japonicus yFS275] gi|212000809|gb|EEB06469.1| heat shock protein [Schizosaccharomyces japonicus yFS275] | Back alignment and taxonomy information |
|---|
| >gi|196015813|ref|XP_002117762.1| hypothetical protein TRIADDRAFT_61844 [Trichoplax adhaerens] gi|190579647|gb|EDV19738.1| hypothetical protein TRIADDRAFT_61844 [Trichoplax adhaerens] | Back alignment and taxonomy information |
|---|
| >gi|391325523|ref|XP_003737282.1| PREDICTED: heat shock 70 kDa protein 14-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 41 | ||||||
| UNIPROTKB|B0YIZ1 | 143 | HSPA14 "Heat shock 70kDa prote | 0.853 | 0.244 | 0.542 | 3.4e-06 | |
| UNIPROTKB|E2RHI0 | 509 | HSPA14 "Uncharacterized protei | 0.853 | 0.068 | 0.542 | 1.4e-05 | |
| UNIPROTKB|F1RTY7 | 509 | LOC100627437 "Uncharacterized | 0.853 | 0.068 | 0.542 | 1.4e-05 | |
| RGD|1303296 | 509 | Hspa14 "heat shock protein 14" | 0.853 | 0.068 | 0.542 | 1.4e-05 | |
| UNIPROTKB|Q2YDD0 | 509 | HSPA14 "Heat shock 70 kDa prot | 0.853 | 0.068 | 0.514 | 1.8e-05 | |
| MGI|MGI:1354164 | 509 | Hspa14 "heat shock protein 14" | 0.853 | 0.068 | 0.514 | 1.8e-05 | |
| UNIPROTKB|Q0VDF9 | 509 | HSPA14 "Heat shock 70 kDa prot | 0.853 | 0.068 | 0.542 | 3.7e-05 | |
| UNIPROTKB|Q4R6J2 | 509 | HSPA14 "Heat shock 70 kDa prot | 0.853 | 0.068 | 0.542 | 3.7e-05 | |
| UNIPROTKB|Q5RE21 | 509 | HSPA14 "Heat shock 70 kDa prot | 0.853 | 0.068 | 0.542 | 3.7e-05 | |
| UNIPROTKB|A2VD93 | 507 | hspa14-b "Heat shock 70 kDa pr | 0.853 | 0.069 | 0.514 | 4.7e-05 |
| UNIPROTKB|B0YIZ1 HSPA14 "Heat shock 70kDa protein 14 isoform 1 variant 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 107 (42.7 bits), Expect = 3.4e-06, P = 3.4e-06
Identities = 19/35 (54%), Positives = 29/35 (82%)
Query: 7 GLYLGNSSASIGICRDGKVEILANEAGDRVTPAVV 41
G++LG +SA + + +DG+ ++AN+AGDRVTPAVV
Sbjct: 5 GVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVV 39
|
|
| UNIPROTKB|E2RHI0 HSPA14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RTY7 LOC100627437 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1303296 Hspa14 "heat shock protein 14" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2YDD0 HSPA14 "Heat shock 70 kDa protein 14" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1354164 Hspa14 "heat shock protein 14" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0VDF9 HSPA14 "Heat shock 70 kDa protein 14" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R6J2 HSPA14 "Heat shock 70 kDa protein 14" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RE21 HSPA14 "Heat shock 70 kDa protein 14" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2VD93 hspa14-b "Heat shock 70 kDa protein 14-B" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 41 | |||
| cd10238 | 375 | cd10238, HSPA14-like_NBD, Nucleotide-binding domai | 6e-13 | |
| cd10241 | 374 | cd10241, HSPA5-like_NBD, Nucleotide-binding domain | 1e-08 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 2e-07 | |
| cd10228 | 381 | cd10228, HSPA4_like_NDB, Nucleotide-binding domain | 3e-07 | |
| cd10232 | 386 | cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma | 6e-07 | |
| cd10233 | 376 | cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding | 1e-05 | |
| cd11739 | 383 | cd11739, HSPH1_NBD, Nucleotide-binding domain of H | 3e-05 | |
| cd11738 | 383 | cd11738, HSPA4L_NBD, Nucleotide-binding domain of | 1e-04 | |
| PTZ00009 | 653 | PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro | 2e-04 | |
| cd11737 | 383 | cd11737, HSPA4_NBD, Nucleotide-binding domain of H | 3e-04 | |
| cd11734 | 373 | cd11734, Ssq1_like_NBD, Nucleotide-binding domain | 5e-04 | |
| cd11732 | 377 | cd11732, HSP105-110_like_NBD, Nucleotide-binding d | 5e-04 | |
| cd10170 | 369 | cd10170, HSP70_NBD, Nucleotide-binding domain of t | 6e-04 | |
| COG0443 | 579 | COG0443, DnaK, Molecular chaperone [Posttranslatio | 0.003 | |
| cd10234 | 376 | cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d | 0.003 |
| >gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins | Back alignment and domain information |
|---|
Score = 59.7 bits (145), Expect = 6e-13
Identities = 19/38 (50%), Positives = 30/38 (78%)
Query: 4 TVFGLYLGNSSASIGICRDGKVEILANEAGDRVTPAVV 41
G++ GN+SA + + +DG+ +++AN+AGDRVTPAVV
Sbjct: 1 AAIGVHFGNTSACLAVYKDGRADVVANDAGDRVTPAVV 38
|
Human HSPA14 (also known as 70-kDa heat shock protein 14, HSP70L1, HSP70-4; the gene encoding HSPA14 maps to 10p13), is ribosome-associated and belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly, and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). HSPA14 interacts with the J-protein MPP11 to form the mammalian ribosome-associated complex (mRAC). HSPA14 participates in a pathway along with Nijmegen breakage syndrome 1 (NBS1, also known as p85 or nibrin), heat shock transcription factor 4b (HSF4b), and HSPA4 (belonging to a different subfamily), that induces tumor migration, invasion, and transformation. HSPA14 is a potent T helper cell (Th1) polarizing adjuvant that contributes to antitumor immune responses. Length = 375 |
| >gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 | Back alignment and domain information |
|---|
| >gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L | Back alignment and domain information |
|---|
| >gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 | Back alignment and domain information |
|---|
| >gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family | Back alignment and domain information |
|---|
| >gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 41 | |||
| KOG0100|consensus | 663 | 99.69 | ||
| PRK11678 | 450 | putative chaperone; Provisional | 99.61 | |
| PRK01433 | 595 | hscA chaperone protein HscA; Provisional | 99.56 | |
| PRK00290 | 627 | dnaK molecular chaperone DnaK; Provisional | 99.55 | |
| PTZ00186 | 657 | heat shock 70 kDa precursor protein; Provisional | 99.54 | |
| PRK13410 | 668 | molecular chaperone DnaK; Provisional | 99.54 | |
| PRK13411 | 653 | molecular chaperone DnaK; Provisional | 99.54 | |
| PTZ00400 | 663 | DnaK-type molecular chaperone; Provisional | 99.53 | |
| PLN03184 | 673 | chloroplast Hsp70; Provisional | 99.53 | |
| CHL00094 | 621 | dnaK heat shock protein 70 | 99.53 | |
| PRK05183 | 616 | hscA chaperone protein HscA; Provisional | 99.52 | |
| TIGR01991 | 599 | HscA Fe-S protein assembly chaperone HscA. The Hea | 99.51 | |
| COG0443 | 579 | DnaK Molecular chaperone [Posttranslational modifi | 99.51 | |
| PTZ00009 | 653 | heat shock 70 kDa protein; Provisional | 99.51 | |
| TIGR02350 | 595 | prok_dnaK chaperone protein DnaK. Members of this | 99.49 | |
| PF00012 | 602 | HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho | 99.43 | |
| KOG0101|consensus | 620 | 99.35 | ||
| KOG0102|consensus | 640 | 99.29 | ||
| KOG0103|consensus | 727 | 98.71 | ||
| TIGR00904 | 333 | mreB cell shape determining protein, MreB/Mrl fami | 97.83 | |
| PRK13928 | 336 | rod shape-determining protein Mbl; Provisional | 97.77 | |
| PRK13929 | 335 | rod-share determining protein MreBH; Provisional | 97.7 | |
| PRK13930 | 335 | rod shape-determining protein MreB; Provisional | 97.46 | |
| PRK13927 | 334 | rod shape-determining protein MreB; Provisional | 97.35 | |
| PRK10939 | 520 | autoinducer-2 (AI-2) kinase; Provisional | 96.99 | |
| PRK04123 | 548 | ribulokinase; Provisional | 96.92 | |
| COG1070 | 502 | XylB Sugar (pentulose and hexulose) kinases [Carbo | 96.76 | |
| PRK00047 | 498 | glpK glycerol kinase; Provisional | 96.47 | |
| PF00370 | 245 | FGGY_N: FGGY family of carbohydrate kinases, N-ter | 96.42 | |
| PRK10331 | 470 | L-fuculokinase; Provisional | 96.37 | |
| PTZ00294 | 504 | glycerol kinase-like protein; Provisional | 96.27 | |
| KOG0104|consensus | 902 | 96.2 | ||
| PF06723 | 326 | MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba | 96.04 | |
| TIGR02628 | 465 | fuculo_kin_coli L-fuculokinase. Members of this fa | 95.87 | |
| PRK15027 | 484 | xylulokinase; Provisional | 95.84 | |
| cd00529 | 154 | RuvC_resolvase Holliday junction resolvases (HJRs) | 95.78 | |
| COG1077 | 342 | MreB Actin-like ATPase involved in cell morphogene | 95.73 | |
| PLN00130 | 213 | succinate dehydrogenase (SDH3); Provisional | 95.66 | |
| TIGR00241 | 248 | CoA_E_activ CoA-substrate-specific enzyme activase | 95.65 | |
| TIGR01315 | 541 | 5C_CHO_kinase FGGY-family pentulose kinase. This m | 95.62 | |
| PF14450 | 120 | FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B | 95.53 | |
| TIGR01311 | 493 | glycerol_kin glycerol kinase. This model describes | 95.46 | |
| smart00732 | 99 | YqgFc Likely ribonuclease with RNase H fold. YqgF | 95.42 | |
| TIGR01314 | 505 | gntK_FGGY gluconate kinase, FGGY type. Gluconate i | 95.38 | |
| TIGR01234 | 536 | L-ribulokinase L-ribulokinase. This enzyme catalyz | 95.21 | |
| PLN02295 | 512 | glycerol kinase | 95.18 | |
| PRK13318 | 258 | pantothenate kinase; Reviewed | 94.31 | |
| PRK13321 | 256 | pantothenate kinase; Reviewed | 94.27 | |
| PF02075 | 149 | RuvC: Crossover junction endodeoxyribonuclease Ruv | 94.0 | |
| PRK00109 | 138 | Holliday junction resolvase-like protein; Reviewed | 93.84 | |
| PF03652 | 135 | UPF0081: Uncharacterised protein family (UPF0081); | 93.75 | |
| PRK13326 | 262 | pantothenate kinase; Reviewed | 93.47 | |
| PLN02669 | 556 | xylulokinase | 93.2 | |
| PRK00039 | 164 | ruvC Holliday junction resolvase; Reviewed | 92.95 | |
| smart00842 | 187 | FtsA Cell division protein FtsA. FtsA is essential | 92.33 | |
| TIGR01312 | 481 | XylB D-xylulose kinase. D-xylulose kinase (XylB) g | 92.28 | |
| COG1069 | 544 | AraB Ribulose kinase [Energy production and conver | 92.26 | |
| TIGR02259 | 432 | benz_CoA_red_A benzoyl-CoA reductase, bcr type, su | 92.13 | |
| PRK00292 | 316 | glk glucokinase; Provisional | 92.12 | |
| PRK13320 | 244 | pantothenate kinase; Reviewed | 91.96 | |
| TIGR03192 | 293 | benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s | 91.79 | |
| PF01548 | 144 | DEDD_Tnp_IS110: Transposase; InterPro: IPR002525 T | 91.62 | |
| COG1548 | 330 | Predicted transcriptional regulator/sugar kinase [ | 91.26 | |
| COG1521 | 251 | Pantothenate kinase type III (Bvg accessory factor | 91.06 | |
| PRK13331 | 251 | pantothenate kinase; Reviewed | 90.89 | |
| PRK09472 | 420 | ftsA cell division protein FtsA; Reviewed | 90.78 | |
| COG0816 | 141 | Predicted endonuclease involved in recombination ( | 90.64 | |
| PF00349 | 206 | Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexo | 90.34 | |
| PRK13317 | 277 | pantothenate kinase; Provisional | 90.3 | |
| TIGR02627 | 454 | rhamnulo_kin rhamnulokinase. This model describes | 89.65 | |
| PF06277 | 473 | EutA: Ethanolamine utilisation protein EutA; Inter | 89.46 | |
| PRK10719 | 475 | eutA reactivating factor for ethanolamine ammonia | 89.39 | |
| TIGR02261 | 262 | benz_CoA_red_D benzoyl-CoA reductase, bcr type, su | 89.13 | |
| COG4820 | 277 | EutJ Ethanolamine utilization protein, possible ch | 88.95 | |
| PF04848 | 143 | Pox_A22: Poxvirus A22 protein; InterPro: IPR006932 | 88.69 | |
| PRK13324 | 258 | pantothenate kinase; Reviewed | 88.34 | |
| TIGR00671 | 243 | baf pantothenate kinase, type III. This model desc | 88.31 | |
| KOG2517|consensus | 516 | 88.27 | ||
| TIGR01174 | 371 | ftsA cell division protein FtsA. This bacterial ce | 87.6 | |
| PF13941 | 457 | MutL: MutL protein | 86.98 | |
| PRK09698 | 302 | D-allose kinase; Provisional | 86.84 | |
| TIGR00250 | 130 | RNAse_H_YqgF RNAse H-fold protein YqgF. This prote | 86.59 | |
| PF07066 | 159 | DUF3882: Lactococcus phage M3 protein; InterPro: I | 86.54 | |
| COG4020 | 332 | Uncharacterized protein conserved in archaea [Func | 86.51 | |
| COG0554 | 499 | GlpK Glycerol kinase [Energy production and conver | 86.08 | |
| smart00268 | 373 | ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki | 85.9 | |
| TIGR01865 | 805 | cas_Csn1 CRISPR-associated protein, Csn1 family. C | 85.77 | |
| PLN02914 | 490 | hexokinase | 85.68 | |
| PRK15080 | 267 | ethanolamine utilization protein EutJ; Provisional | 85.68 | |
| PF03309 | 206 | Pan_kinase: Type III pantothenate kinase; InterPro | 85.67 | |
| TIGR03286 | 404 | methan_mark_15 putative methanogenesis marker prot | 85.46 | |
| PLN02362 | 509 | hexokinase | 85.24 | |
| PRK14101 | 638 | bifunctional glucokinase/RpiR family transcription | 84.21 | |
| TIGR01175 | 348 | pilM type IV pilus assembly protein PilM. This pro | 84.14 | |
| COG1924 | 396 | Activator of 2-hydroxyglutaryl-CoA dehydratase (HS | 84.13 | |
| PRK12408 | 336 | glucokinase; Provisional | 84.04 | |
| COG0849 | 418 | ftsA Cell division ATPase FtsA [Cell division and | 83.74 | |
| PF01385 | 227 | OrfB_IS605: Probable transposase; InterPro: IPR001 | 83.09 | |
| COG2410 | 178 | Predicted nuclease (RNAse H fold) [General functio | 82.34 | |
| PRK13311 | 256 | N-acetyl-D-glucosamine kinase; Provisional | 82.06 | |
| PTZ00288 | 405 | glucokinase 1; Provisional | 81.15 | |
| PLN02405 | 497 | hexokinase | 81.02 | |
| cd00012 | 371 | ACTIN Actin; An ubiquitous protein involved in the | 80.51 | |
| PLN02596 | 490 | hexokinase-like | 80.28 |
| >KOG0100|consensus | Back alignment and domain information |
|---|
Probab=99.69 E-value=3.6e-17 Score=100.47 Aligned_cols=39 Identities=44% Similarity=0.883 Sum_probs=37.5
Q ss_pred ceEEEEeCCcceEEEEEEeCCeEEEEeCCCCCeeeEeeC
Q psy17247 3 KTVFGLYLGNSSASIGICRDGKVEILANEAGDRVTPAVV 41 (41)
Q Consensus 3 ~~~iGiD~GTtns~va~~~~~~~~ii~~~~~~~~~pS~V 41 (41)
..+||||||||||||+++++|+++||+|++|+|.+||+|
T Consensus 36 gtvigIdLGTTYsCVgV~kNgrvEIiANdQGNRItPSyV 74 (663)
T KOG0100|consen 36 GTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYV 74 (663)
T ss_pred ceEEEEecCCceeeEEEEeCCeEEEEecCCCCcccccee
Confidence 468999999999999999999999999999999999997
|
|
| >PRK11678 putative chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK01433 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >PRK00290 dnaK molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PTZ00186 heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >PRK13410 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PRK13411 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PTZ00400 DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >PLN03184 chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >CHL00094 dnaK heat shock protein 70 | Back alignment and domain information |
|---|
| >PRK05183 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >TIGR01991 HscA Fe-S protein assembly chaperone HscA | Back alignment and domain information |
|---|
| >COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00009 heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02350 prok_dnaK chaperone protein DnaK | Back alignment and domain information |
|---|
| >PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins | Back alignment and domain information |
|---|
| >KOG0101|consensus | Back alignment and domain information |
|---|
| >KOG0102|consensus | Back alignment and domain information |
|---|
| >KOG0103|consensus | Back alignment and domain information |
|---|
| >TIGR00904 mreB cell shape determining protein, MreB/Mrl family | Back alignment and domain information |
|---|
| >PRK13928 rod shape-determining protein Mbl; Provisional | Back alignment and domain information |
|---|
| >PRK13929 rod-share determining protein MreBH; Provisional | Back alignment and domain information |
|---|
| >PRK13930 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >PRK13927 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >PRK10939 autoinducer-2 (AI-2) kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04123 ribulokinase; Provisional | Back alignment and domain information |
|---|
| >COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00047 glpK glycerol kinase; Provisional | Back alignment and domain information |
|---|
| >PF00370 FGGY_N: FGGY family of carbohydrate kinases, N-terminal domain; InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related | Back alignment and domain information |
|---|
| >PRK10331 L-fuculokinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00294 glycerol kinase-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0104|consensus | Back alignment and domain information |
|---|
| >PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes | Back alignment and domain information |
|---|
| >TIGR02628 fuculo_kin_coli L-fuculokinase | Back alignment and domain information |
|---|
| >PRK15027 xylulokinase; Provisional | Back alignment and domain information |
|---|
| >cd00529 RuvC_resolvase Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination | Back alignment and domain information |
|---|
| >COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN00130 succinate dehydrogenase (SDH3); Provisional | Back alignment and domain information |
|---|
| >TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative | Back alignment and domain information |
|---|
| >TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase | Back alignment and domain information |
|---|
| >PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T | Back alignment and domain information |
|---|
| >TIGR01311 glycerol_kin glycerol kinase | Back alignment and domain information |
|---|
| >smart00732 YqgFc Likely ribonuclease with RNase H fold | Back alignment and domain information |
|---|
| >TIGR01314 gntK_FGGY gluconate kinase, FGGY type | Back alignment and domain information |
|---|
| >TIGR01234 L-ribulokinase L-ribulokinase | Back alignment and domain information |
|---|
| >PLN02295 glycerol kinase | Back alignment and domain information |
|---|
| >PRK13318 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK13321 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF02075 RuvC: Crossover junction endodeoxyribonuclease RuvC; InterPro: IPR002176 The Escherichia coli ruvC gene is involved in DNA repair and in the late step of RecE and RecF pathway recombination [] | Back alignment and domain information |
|---|
| >PRK00109 Holliday junction resolvase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination | Back alignment and domain information |
|---|
| >PRK13326 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN02669 xylulokinase | Back alignment and domain information |
|---|
| >PRK00039 ruvC Holliday junction resolvase; Reviewed | Back alignment and domain information |
|---|
| >smart00842 FtsA Cell division protein FtsA | Back alignment and domain information |
|---|
| >TIGR01312 XylB D-xylulose kinase | Back alignment and domain information |
|---|
| >COG1069 AraB Ribulose kinase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A | Back alignment and domain information |
|---|
| >PRK00292 glk glucokinase; Provisional | Back alignment and domain information |
|---|
| >PRK13320 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit | Back alignment and domain information |
|---|
| >PF01548 DEDD_Tnp_IS110: Transposase; InterPro: IPR002525 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >COG1548 Predicted transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1521 Pantothenate kinase type III (Bvg accessory factor family protein) [Transcription] | Back alignment and domain information |
|---|
| >PRK13331 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK09472 ftsA cell division protein FtsA; Reviewed | Back alignment and domain information |
|---|
| >COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B | Back alignment and domain information |
|---|
| >PF00349 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P) | Back alignment and domain information |
|---|
| >PRK13317 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02627 rhamnulo_kin rhamnulokinase | Back alignment and domain information |
|---|
| >PF06277 EutA: Ethanolamine utilisation protein EutA; InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon | Back alignment and domain information |
|---|
| >PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D | Back alignment and domain information |
|---|
| >COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF04848 Pox_A22: Poxvirus A22 protein; InterPro: IPR006932 This family, representing the Poxvirus A22 protein, is a Holliday junction resolvase, it specifically cleaves and resolves four-way DNA Holliday junctions into linear duplex products | Back alignment and domain information |
|---|
| >PRK13324 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00671 baf pantothenate kinase, type III | Back alignment and domain information |
|---|
| >KOG2517|consensus | Back alignment and domain information |
|---|
| >TIGR01174 ftsA cell division protein FtsA | Back alignment and domain information |
|---|
| >PF13941 MutL: MutL protein | Back alignment and domain information |
|---|
| >PRK09698 D-allose kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00250 RNAse_H_YqgF RNAse H-fold protein YqgF | Back alignment and domain information |
|---|
| >PF07066 DUF3882: Lactococcus phage M3 protein; InterPro: IPR009773 This family consists of several Lactococcus bacteriophage 712, middle-3 (M3) proteins of around 160 residues in length | Back alignment and domain information |
|---|
| >COG4020 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >COG0554 GlpK Glycerol kinase [Energy production and conversion] | Back alignment and domain information |
|---|
| >smart00268 ACTIN Actin | Back alignment and domain information |
|---|
| >TIGR01865 cas_Csn1 CRISPR-associated protein, Csn1 family | Back alignment and domain information |
|---|
| >PLN02914 hexokinase | Back alignment and domain information |
|---|
| >PRK15080 ethanolamine utilization protein EutJ; Provisional | Back alignment and domain information |
|---|
| >PF03309 Pan_kinase: Type III pantothenate kinase; InterPro: IPR004619 Pantothenate kinase (PanK or CoaA) catalyses the first step of the universal five step coenzyme A (CoA) biosynthesis pathway | Back alignment and domain information |
|---|
| >TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 | Back alignment and domain information |
|---|
| >PLN02362 hexokinase | Back alignment and domain information |
|---|
| >PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR01175 pilM type IV pilus assembly protein PilM | Back alignment and domain information |
|---|
| >COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK12408 glucokinase; Provisional | Back alignment and domain information |
|---|
| >COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF01385 OrfB_IS605: Probable transposase; InterPro: IPR001959 This entry represents a conserved region of a probable transposase family, which is found in a number of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG2410 Predicted nuclease (RNAse H fold) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13311 N-acetyl-D-glucosamine kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00288 glucokinase 1; Provisional | Back alignment and domain information |
|---|
| >PLN02405 hexokinase | Back alignment and domain information |
|---|
| >cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton | Back alignment and domain information |
|---|
| >PLN02596 hexokinase-like | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 41 | ||||
| 3qfu_A | 394 | Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE | 3e-05 | ||
| 3qfp_A | 390 | Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D | 3e-05 | ||
| 3iuc_A | 408 | Crystal Structure Of The Human 70kda Heat Shock Pro | 4e-05 | ||
| 3ldl_A | 384 | Crystal Structure Of Human Grp78 (70kda Heat Shock | 4e-05 | ||
| 1ba1_A | 386 | Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi | 3e-04 | ||
| 4gni_A | 409 | Structure Of The Ssz1 Atpase Bound To Atp And Magne | 3e-04 | ||
| 1ngg_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 5e-04 | ||
| 1ngh_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 5e-04 | ||
| 3fe1_A | 403 | Crystal Structure Of The Human 70kda Heat Shock Pro | 5e-04 | ||
| 1bup_A | 386 | T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot | 5e-04 | ||
| 3i33_A | 404 | Crystal Structure Of The Human 70kda Heat Shock Pro | 6e-04 | ||
| 1s3x_A | 382 | The Crystal Structure Of The Human Hsp70 Atpase Dom | 6e-04 | ||
| 1yuw_A | 554 | Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 | 6e-04 | ||
| 3cqx_A | 386 | Chaperone Complex Length = 386 | 6e-04 | ||
| 3c7n_B | 554 | Structure Of The Hsp110:hsc70 Nucleotide Exchange C | 6e-04 | ||
| 1kax_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71m | 6e-04 | ||
| 1kay_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71a | 6e-04 | ||
| 1nga_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 6e-04 | ||
| 1kaz_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71e | 6e-04 | ||
| 1ats_A | 386 | Threonine 204 Of The Chaperone Protein Hsc70 Influe | 6e-04 | ||
| 1ngb_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 6e-04 | ||
| 1atr_A | 386 | Threonine 204 Of The Chaperone Protein Hsc70 Influe | 6e-04 | ||
| 2qwn_A | 394 | Crystal Structure Of Disulfide-Bond-Crosslinked Com | 6e-04 | ||
| 1ba0_A | 386 | Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi | 6e-04 | ||
| 1ngc_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 6e-04 | ||
| 1qqo_A | 378 | E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 6e-04 | ||
| 1nge_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 6e-04 | ||
| 2qw9_B | 394 | Crystal Structure Of Bovine Hsc70 (1-394aa)in The A | 6e-04 | ||
| 1qqm_A | 378 | D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 6e-04 | ||
| 1hpm_A | 386 | How Potassium Affects The Activity Of The Molecular | 6e-04 | ||
| 1ngd_A | 386 | Structural Basis Of The 70-kilodalton Heat Shock Co | 6e-04 | ||
| 1ngf_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 6e-04 | ||
| 1qqn_A | 378 | D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 6e-04 | ||
| 3c7n_A | 668 | Structure Of The Hsp110:hsc70 Nucleotide Exchange C | 8e-04 | ||
| 2qxl_A | 658 | Crystal Structure Analysis Of Sse1, A Yeast Hsp110 | 8e-04 | ||
| 2bup_A | 381 | T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 | 8e-04 | ||
| 1hjo_A | 380 | Atpase Domain Of Human Heat Shock 70kda Protein 1 L | 9e-04 | ||
| 3d2f_B | 382 | Crystal Structure Of A Complex Of Sse1p And Hsp70 L | 9e-04 | ||
| 3d2f_A | 675 | Crystal Structure Of A Complex Of Sse1p And Hsp70 L | 9e-04 | ||
| 3d2e_A | 675 | Crystal Structure Of A Complex Of Sse1p And Hsp70, | 9e-04 | ||
| 2e8a_A | 391 | Crystal Structure Of The Human Hsp70 Atpase Domain | 9e-04 | ||
| 2e88_A | 391 | Crystal Structure Of The Human Hsp70 Atpase Domain | 9e-04 | ||
| 3jxu_A | 409 | Crystal Structure Of The Human 70kda Heat Shock Pro | 9e-04 | ||
| 3d2e_B | 382 | Crystal Structure Of A Complex Of Sse1p And Hsp70, | 9e-04 | ||
| 3a8y_A | 392 | Crystal Structure Of The Complex Between The Bag5 B | 9e-04 |
| >pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 | Back alignment and structure |
| >pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 | Back alignment and structure |
| >pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 | Back alignment and structure |
| >pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 | Back alignment and structure |
| >pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 | Back alignment and structure |
| >pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 | Back alignment and structure |
| >pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 | Back alignment and structure |
| >pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 | Back alignment and structure |
| >pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 | Back alignment and structure |
| >pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 | Back alignment and structure |
| >pdb|3CQX|A Chain A, Chaperone Complex Length = 386 | Back alignment and structure |
| >pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 | Back alignment and structure |
| >pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 | Back alignment and structure |
| >pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 | Back alignment and structure |
| >pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 | Back alignment and structure |
| >pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 | Back alignment and structure |
| >pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 | Back alignment and structure |
| >pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 | Back alignment and structure |
| >pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 | Back alignment and structure |
| >pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State Length = 394 | Back alignment and structure |
| >pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 | Back alignment and structure |
| >pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 | Back alignment and structure |
| >pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 | Back alignment and structure |
| >pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 | Back alignment and structure |
| >pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 | Back alignment and structure |
| >pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 | Back alignment and structure |
| >pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 | Back alignment and structure |
| >pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 | Back alignment and structure |
| >pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 | Back alignment and structure |
| >pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 | Back alignment and structure |
| >pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 | Back alignment and structure |
| >pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 | Back alignment and structure |
| >pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 41 | |||
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 7e-09 | |
| 1yuw_A | 554 | Heat shock cognate 71 kDa protein; chaperone; 2.60 | 1e-06 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 3e-06 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 4e-06 |
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 | Back alignment and structure |
|---|
Score = 47.3 bits (113), Expect = 7e-09
Identities = 18/41 (43%), Positives = 29/41 (70%), Gaps = 1/41 (2%)
Query: 1 MSKTVFGLYLGNSSASIGICRDGKVEILANEAGDRVTPAVV 41
MS T FGL LGN+++ + + R+ ++I+ NE +R TP+VV
Sbjct: 1 MS-TPFGLDLGNNNSVLAVARNRGIDIVVNEVSNRSTPSVV 40
|
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 41 | |||
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 99.57 | |
| 4b9q_A | 605 | Chaperone protein DNAK; HET: ATP; 2.40A {Escherich | 99.55 | |
| 1yuw_A | 554 | Heat shock cognate 71 kDa protein; chaperone; 2.60 | 99.54 | |
| 4gni_A | 409 | Putative heat shock protein; HSP70-type ATPase, AT | 99.52 | |
| 2kho_A | 605 | Heat shock protein 70; molecular chaperone, HSP70, | 99.52 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 99.48 | |
| 1dkg_D | 383 | Molecular chaperone DNAK; HSP70, GRPE, nucleotide | 99.48 | |
| 2v7y_A | 509 | Chaperone protein DNAK; HSP70, heat shock protein, | 99.44 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 99.41 | |
| 1jce_A | 344 | ROD shape-determining protein MREB; MBL, actin, HS | 98.51 | |
| 4ehu_A | 276 | Activator of 2-hydroxyisocaproyl-COA dehydratase; | 97.82 | |
| 2ych_A | 377 | Competence protein PILM; cell cycle, type IV pilus | 97.6 | |
| 3hz6_A | 511 | Xylulokinase; xylulose, structural genomic, chromo | 97.02 | |
| 3g25_A | 501 | Glycerol kinase; IDP00743, ATP-binding, glycerol m | 96.99 | |
| 3h6e_A | 482 | Carbohydrate kinase, FGGY; novosphingobium aromati | 96.99 | |
| 2zf5_O | 497 | Glycerol kinase; hyperthermophilic archaeon, ATP-b | 96.92 | |
| 2zgy_A | 320 | Plasmid segregation protein PARM; plasmid partitio | 96.91 | |
| 1k8k_A | 418 | ARP3, actin-like protein 3, actin-2; beta-propelle | 96.9 | |
| 4e1j_A | 520 | Glycerol kinase; structural genomics, PSI-biology, | 96.9 | |
| 2w40_A | 503 | Glycerol kinase, putative; closed conformation, ma | 96.72 | |
| 1hux_A | 270 | Activator of (R)-2-hydroxyglutaryl-COA dehydratase | 96.51 | |
| 3ll3_A | 504 | Gluconate kinase; xylulose kinase, nysgx, ATP, ADP | 96.43 | |
| 1nu0_A | 138 | Hypothetical protein YQGF; structural genomics, st | 96.4 | |
| 3ezw_A | 526 | Glycerol kinase; glycerol metabolism, allosteric r | 96.28 | |
| 3l0q_A | 554 | Xylulose kinase; xlylulose kinase, SGX, PSI, struc | 96.27 | |
| 3h3n_X | 506 | Glycerol kinase; ATP-binding, glycerol metabolism, | 96.22 | |
| 2p3r_A | 510 | Glycerol kinase; glycerol metabolism, allosteric r | 96.21 | |
| 3i8b_A | 515 | Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 | 96.21 | |
| 3jvp_A | 572 | Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su | 96.15 | |
| 1vhx_A | 150 | Putative holliday junction resolvase; structural g | 96.11 | |
| 3ifr_A | 508 | Carbohydrate kinase, FGGY; xylulose kinase, SGX, s | 96.04 | |
| 4bc3_A | 538 | Xylulose kinase; transferase, glucuronate xyluloki | 96.01 | |
| 2dpn_A | 495 | Glycerol kinase; thermus thermophilus HB8, structu | 96.0 | |
| 3djc_A | 266 | Type III pantothenate kinase; structural genomics, | 95.76 | |
| 3bex_A | 249 | Type III pantothenate kinase; actin-like fold, ATP | 95.69 | |
| 1hjr_A | 158 | Holliday junction resolvase (RUVC); site-specific | 95.56 | |
| 2e2o_A | 299 | Hexokinase; acetate and sugar kinases, HSP70, acti | 95.47 | |
| 2uyt_A | 489 | Rhamnulokinase; rhamnose degradation, IN-LINE phos | 95.46 | |
| 1zc6_A | 305 | Probable N-acetylglucosamine kinase; NESG, Q7NU07_ | 95.43 | |
| 2ch5_A | 347 | NAGK protein; transferase, N-acetylglucosamine, gl | 95.38 | |
| 2fxu_A | 375 | Alpha-actin-1, actin, alpha skeletal muscle; actin | 95.28 | |
| 2d4w_A | 504 | Glycerol kinase; alpha and beta protein, ribonucle | 95.2 | |
| 2itm_A | 484 | Xylulose kinase, xylulokinase; ATPase, FGGY kinase | 94.98 | |
| 2qm1_A | 326 | Glucokinase; alpha-beta structure, putative helix- | 94.81 | |
| 2fsj_A | 346 | Hypothetical protein TA0583; actin homologs, archa | 94.68 | |
| 2f9w_A | 271 | Pantothenate kinase; COAA, transferase; HET: PAU; | 94.65 | |
| 4ep4_A | 166 | Crossover junction endodeoxyribonuclease RUVC; res | 94.4 | |
| 1iv0_A | 98 | Hypothetical protein; rnaseh-like, YQGF, structura | 94.0 | |
| 1zbs_A | 291 | Hypothetical protein PG1100; alpha-beta protein., | 93.48 | |
| 3nuw_A | 295 | 2-OXO-3-deoxygalactonate kinase; structural genomi | 93.46 | |
| 3h1q_A | 272 | Ethanolamine utilization protein EUTJ; ethanolamin | 93.43 | |
| 3vgl_A | 321 | Glucokinase; ROK family, transferase; HET: BGC ANP | 93.15 | |
| 2h3g_X | 268 | Biosynthetic protein; pantothenate kinase, anthrax | 92.74 | |
| 1nbw_A | 607 | Glycerol dehydratase reactivase alpha subunit; mol | 91.78 | |
| 1zxo_A | 291 | Conserved hypothetical protein Q8A1P1; NESG, BTR25 | 91.74 | |
| 1saz_A | 381 | Probable butyrate kinase 2; askha (acetate and sug | 91.37 | |
| 3vov_A | 302 | Glucokinase, hexokinase; ROK, sugar kinase, transf | 91.33 | |
| 1sz2_A | 332 | Glucokinase, glucose kinase; ATP-dependent, glucos | 90.91 | |
| 2ews_A | 287 | Pantothenate kinase; PANK, structural genomics, st | 90.63 | |
| 4htl_A | 297 | Beta-glucoside kinase; structural genomics, sugar | 90.58 | |
| 3htv_A | 310 | D-allose kinase, allokinase; NP_418508.1, structur | 90.5 | |
| 2yhw_A | 343 | Bifunctional UDP-N-acetylglucosamine 2-epimerase/N | 89.9 | |
| 1k8k_B | 394 | ARP2, actin-like protein 2; beta-propeller, struct | 89.21 | |
| 3r8e_A | 321 | Hypothetical sugar kinase; ribonuclease H-like mot | 89.15 | |
| 1bdg_A | 451 | Hexokinase; phosphotransferase; HET: GLC; 2.60A {S | 88.84 | |
| 2ivn_A | 330 | O-sialoglycoprotein endopeptidase; UP1 keops compl | 88.74 | |
| 2q2r_A | 373 | Glucokinase 1, putative; ATPase hexose kinase fami | 88.5 | |
| 3mcp_A | 366 | Glucokinase; structural genomics, joint center for | 88.23 | |
| 2aa4_A | 289 | Mannac kinase, putative N-acetylmannosamine kinase | 88.22 | |
| 2yhx_A | 457 | Hexokinase B; transferase(phosphoryl,alcohol accep | 88.16 | |
| 3epq_A | 302 | Putative fructokinase; SCRK, ADP binding, PSI2, MC | 88.07 | |
| 2gup_A | 292 | ROK family protein; sugar kinase, streptococcus pn | 87.55 | |
| 3t69_A | 330 | Putative 2-dehydro-3-deoxygalactonokinase; structu | 87.1 | |
| 4a2a_A | 419 | Cell division protein FTSA, putative; cell cycle, | 86.91 | |
| 4db3_A | 327 | Glcnac kinase, N-acetyl-D-glucosamine kinase; stru | 86.63 | |
| 1z6r_A | 406 | MLC protein; transcriptional repressor, ROK family | 86.09 | |
| 3qb0_A | 498 | Actin-related protein 4; actin fold, ATP binding, | 86.08 | |
| 1woq_A | 267 | Inorganic polyphosphate/ATP-glucomannokinase; tran | 86.07 | |
| 2hoe_A | 380 | N-acetylglucosamine kinase; TM1224, structural gen | 85.85 | |
| 2ap1_A | 327 | Putative regulator protein; zinc binding protein, | 84.76 | |
| 3o8m_A | 485 | Hexokinase; rnaseh-like fold, glycolysis, glucose | 84.57 | |
| 3mdq_A | 315 | Exopolyphosphatase; structural genomics, joint cen | 84.27 | |
| 1cza_N | 917 | Hexokinase type I; structurally homologous domains | 83.44 | |
| 1cza_N | 917 | Hexokinase type I; structurally homologous domains | 82.7 | |
| 2d0o_A | 610 | DIOL dehydratase-reactivating factor large subunit | 82.36 | |
| 1z05_A | 429 | Transcriptional regulator, ROK family; structural | 82.01 | |
| 3lm2_A | 226 | Putative kinase; structural genomics, joint center | 81.7 | |
| 4dkw_A | 211 | Large terminase protein; DNA-packaging, small term | 81.36 |
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* | Back alignment and structure |
|---|
Probab=99.57 E-value=2.5e-15 Score=92.89 Aligned_cols=40 Identities=45% Similarity=0.779 Sum_probs=36.6
Q ss_pred CCceEEEEeCCcceEEEEEEeCCeEEEEeCCCCCeeeEeeC
Q psy17247 1 MSKTVFGLYLGNSSASIGICRDGKVEILANEAGDRVTPAVV 41 (41)
Q Consensus 1 m~~~~iGiD~GTtns~va~~~~~~~~ii~~~~~~~~~pS~V 41 (41)
|+ .+|||||||||||||+++++++++++|++|++.+||+|
T Consensus 1 Mm-~~iGIDlGTtns~va~~~~g~~~ii~n~~g~r~tPS~V 40 (675)
T 3d2f_A 1 MS-TPFGLDLGNNNSVLAVARNRGIDIVVNEVSNRSTPSVV 40 (675)
T ss_dssp -C-CCEEEECCSSEEEEEEEETTEEEEECCTTSCSSEECCE
T ss_pred CC-cEEEEEcCCCcEEEEEEECCeeEEEECCCCCcccceEE
Confidence 44 48999999999999999999999999999999999986
|
| >4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D | Back alignment and structure |
|---|
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* | Back alignment and structure |
|---|
| >4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A | Back alignment and structure |
|---|
| >4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A | Back alignment and structure |
|---|
| >2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* | Back alignment and structure |
|---|
| >3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* | Back alignment and structure |
|---|
| >3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} | Back alignment and structure |
|---|
| >2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A | Back alignment and structure |
|---|
| >1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A | Back alignment and structure |
|---|
| >4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* | Back alignment and structure |
|---|
| >1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 | Back alignment and structure |
|---|
| >3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* | Back alignment and structure |
|---|
| >1nu0_A Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} SCOP: c.55.3.8 PDB: 1nmn_A 1ovq_A | Back alignment and structure |
|---|
| >3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* | Back alignment and structure |
|---|
| >3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* | Back alignment and structure |
|---|
| >3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O | Back alignment and structure |
|---|
| >3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} | Back alignment and structure |
|---|
| >1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 | Back alignment and structure |
|---|
| >3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* | Back alignment and structure |
|---|
| >2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3djc_A Type III pantothenate kinase; structural genomics, putative transfera 2, protein structure initiative; 2.40A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3bex_A Type III pantothenate kinase; actin-like fold, ATP-binding, coenzyme A biosynthesis, cytoplasm, metal-binding, nucleotide-binding, potassium; HET: PAU; 1.51A {Thermotoga maritima} SCOP: c.55.1.13 c.55.1.13 PDB: 3bf1_A* 3bf3_A* 2gtd_A | Back alignment and structure |
|---|
| >1hjr_A Holliday junction resolvase (RUVC); site-specific recombinase; 2.50A {Escherichia coli} SCOP: c.55.3.6 | Back alignment and structure |
|---|
| >2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* | Back alignment and structure |
|---|
| >2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* | Back alignment and structure |
|---|
| >1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, struc genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum} SCOP: c.55.1.5 c.55.1.5 | Back alignment and structure |
|---|
| >2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* | Back alignment and structure |
|---|
| >2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... | Back alignment and structure |
|---|
| >2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} | Back alignment and structure |
|---|
| >2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A | Back alignment and structure |
|---|
| >2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* | Back alignment and structure |
|---|
| >2f9w_A Pantothenate kinase; COAA, transferase; HET: PAU; 1.90A {Pseudomonas aeruginosa} SCOP: c.55.1.13 c.55.1.13 PDB: 2f9t_A* | Back alignment and structure |
|---|
| >4ep4_A Crossover junction endodeoxyribonuclease RUVC; resolvase, hydrolase; 1.28A {Thermus thermophilus} PDB: 4ep5_A | Back alignment and structure |
|---|
| >1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 | Back alignment and structure |
|---|
| >1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.30A {Porphyromonas gingivalis} SCOP: c.55.1.5 c.55.1.5 | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} | Back alignment and structure |
|---|
| >3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A* | Back alignment and structure |
|---|
| >2h3g_X Biosynthetic protein; pantothenate kinase, anthrax, type III pantothenate kinase, COAX, COAA, askha; 2.00A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 | Back alignment and structure |
|---|
| >1zxo_A Conserved hypothetical protein Q8A1P1; NESG, BTR25, structural genomics, PSI, protein structure initiative; 3.20A {Bacteroides thetaiotaomicron} SCOP: c.55.1.5 c.55.1.5 | Back alignment and structure |
|---|
| >1saz_A Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} SCOP: c.55.1.2 c.55.1.2 PDB: 1x9j_A* | Back alignment and structure |
|---|
| >3vov_A Glucokinase, hexokinase; ROK, sugar kinase, transferase; 2.02A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1sz2_A Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} SCOP: c.55.1.7 PDB: 1q18_A* | Back alignment and structure |
|---|
| >2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 | Back alignment and structure |
|---|
| >4htl_A Beta-glucoside kinase; structural genomics, sugar kinase, ROK family, PSI-biology, center for structural genomics, MCSG, transferase; HET: MSE; 1.64A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2yhw_A Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; transferase, sialic acid, mannac, ROK family; HET: BM3 2PE; 1.64A {Homo sapiens} PDB: 2yhy_A* 2yi1_A* 3eo3_A | Back alignment and structure |
|---|
| >1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* | Back alignment and structure |
|---|
| >3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 | Back alignment and structure |
|---|
| >2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* | Back alignment and structure |
|---|
| >2q2r_A Glucokinase 1, putative; ATPase hexose kinase family, transferase; HET: BGC ADP; 2.10A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3mcp_A Glucokinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; 3.00A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A | Back alignment and structure |
|---|
| >2gup_A ROK family protein; sugar kinase, streptococcus pneumoniae TIGR4, AP sucrose, structural genomics, PSI; HET: SUC; 2.01A {Streptococcus pneumoniae} SCOP: c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >3t69_A Putative 2-dehydro-3-deoxygalactonokinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.55A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* | Back alignment and structure |
|---|
| >4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A | Back alignment and structure |
|---|
| >3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1woq_A Inorganic polyphosphate/ATP-glucomannokinase; transferase; HET: BGC; 1.80A {Arthrobacter SP} SCOP: c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* | Back alignment and structure |
|---|
| >3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* | Back alignment and structure |
|---|
| >1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* | Back alignment and structure |
|---|
| >2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A | Back alignment and structure |
|---|
| >1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >3lm2_A Putative kinase; structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2, transf; HET: MSE; 1.70A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >4dkw_A Large terminase protein; DNA-packaging, small terminase, nuclease FO endonuclease, DNA, DNA-packaging motor, hydrolase; 2.02A {Enterobacteria phage P22} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 41 | ||||
| d1bupa1 | 185 | c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas | 1e-06 | |
| d1dkgd1 | 183 | c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas | 1e-05 |
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Heat shock protein 70kDa, ATPase fragment species: Cow (Bos taurus) [TaxId: 9913]
Score = 39.6 bits (92), Expect = 1e-06
Identities = 16/38 (42%), Positives = 27/38 (71%)
Query: 4 TVFGLYLGNSSASIGICRDGKVEILANEAGDRVTPAVV 41
G+ LG++ + +G+ + GKVEI+AN+ G+R TP+ V
Sbjct: 2 PAVGIDLGSTYSCVGVFQHGKVEIIANDQGNRTTPSYV 39
|
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 41 | |||
| d1bupa1 | 185 | Heat shock protein 70kDa, ATPase fragment {Cow (Bo | 99.65 | |
| d1dkgd1 | 183 | Heat shock protein 70kDa, ATPase fragment {Escheri | 99.6 | |
| d1jcea1 | 137 | Prokaryotic actin homolog MreB {Thermotoga maritim | 98.82 | |
| d1huxa_ | 259 | Hydroxyglutaryl-CoA dehydratase component A {Acida | 97.41 | |
| d1zc6a1 | 114 | Probable N-acetylglucosamine kinase CV2896 {Chromo | 97.18 | |
| d2p3ra1 | 252 | Glycerol kinase {Escherichia coli [TaxId: 562]} | 96.95 | |
| d1nu0a_ | 138 | Hypothetical protein YqgF (RuvX) {Escherichia coli | 96.76 | |
| d1r59o1 | 252 | Glycerol kinase {Enterococcus casseliflavus [TaxId | 96.48 | |
| d2ch5a2 | 117 | N-acetylglucosamine kinase, NAGK {Human (Homo sapi | 96.39 | |
| d1q18a1 | 110 | Glucokinase Glk {Escherichia coli [TaxId: 562]} | 96.32 | |
| d1woqa1 | 129 | Inorganic polyphosphate/ATP-glucomannokinase PPGMK | 96.27 | |
| d2ap1a2 | 117 | Putative regulator protein YcfX {Salmonella typhim | 95.86 | |
| d2aa4a1 | 119 | N-acetylmannosamine kinase NanK {Escherichia coli | 95.62 | |
| d2ewsa1 | 267 | Type II pantothenate kinase, CoaW {Staphylococcus | 95.37 | |
| d1vhxa_ | 140 | Hypothetical protein YrrK (RuvX) {Bacillus subtili | 95.08 | |
| d3bexa1 | 118 | Type III pantothenate kinase, CoaX {Thermotoga mar | 94.83 | |
| d1hjra_ | 158 | RuvC resolvase {Escherichia coli [TaxId: 562]} | 94.71 | |
| d2gupa1 | 114 | Hypothetical protein SP2142 {Streptococcus pneumon | 94.54 | |
| d1iv0a_ | 98 | Hypothetical protein, YqgF homologue {Thermus ther | 94.17 | |
| d2f9wa2 | 114 | Type III pantothenate kinase, CoaX {Pseudomonas ae | 93.79 | |
| d1xc3a1 | 118 | Putative fructokinase YhdR {Bacillus subtilis [Tax | 93.46 | |
| d1e4ft1 | 193 | Cell division protein FtsA {Thermotoga maritima [T | 93.37 | |
| d2hoea3 | 128 | N-acetylglucosamine kinase {Thermotoga maritima [T | 92.76 | |
| d2d0oa2 | 241 | Diol dehydratase-reactivating factor large subunit | 91.32 | |
| d1nbwa2 | 239 | ATPase domain of the glycerol dehydratase reactiva | 91.08 | |
| d1sz2a1 | 319 | Glucokinase Glk {Escherichia coli [TaxId: 562]} | 90.88 | |
| d1czan3 | 205 | Mammalian type I hexokinase {Human (Homo sapiens) | 90.76 | |
| d2fsja2 | 164 | Hypothetical protein Ta0583 {Archaeon Thermoplasma | 89.23 | |
| d1v4sa1 | 205 | Glucokinase {Human (Homo sapiens) [TaxId: 9606]} | 88.11 | |
| d1bdga1 | 208 | Hexokinase {Blood fluke (Schistosoma mansoni) [Tax | 88.05 | |
| d1ig8a1 | 207 | Hexokinase {Baker's yeast (Saccharomyces cerevisia | 88.04 | |
| d1czan1 | 207 | Mammalian type I hexokinase {Human (Homo sapiens) | 87.49 | |
| d1z05a3 | 128 | Transcriptional regulator VC2007 {Vibrio cholerae | 86.36 | |
| d1z6ra2 | 129 | Mlc protein {Escherichia coli [TaxId: 562]} | 82.68 | |
| d2zgya1 | 157 | Plasmid segregation protein ParM {Escherichia coli | 81.84 |
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Heat shock protein 70kDa, ATPase fragment species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.65 E-value=5.1e-17 Score=86.07 Aligned_cols=39 Identities=41% Similarity=0.780 Sum_probs=36.5
Q ss_pred ceEEEEeCCcceEEEEEEeCCeEEEEeCCCCCeeeEeeC
Q psy17247 3 KTVFGLYLGNSSASIGICRDGKVEILANEAGDRVTPAVV 41 (41)
Q Consensus 3 ~~~iGiD~GTtns~va~~~~~~~~ii~~~~~~~~~pS~V 41 (41)
.++||||||||||+||++++|++++++++++++.+||+|
T Consensus 1 g~vvGIDfGTt~s~va~~~~g~~~ii~~~~~~r~~Ps~i 39 (185)
T d1bupa1 1 GPAVGIDLGSTYSCVGVFQHGKVEIIANDQGNRTTPSYV 39 (185)
T ss_dssp CCCEEEEECSSEEEEEEEETTEEEECCCTTSCSSEECCE
T ss_pred CCEEEEEcChhcEEEEEEECCEEEEEECCCCCccceeEE
Confidence 368999999999999999999999999999999999975
|
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} | Back information, alignment and structure |
|---|
| >d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} | Back information, alignment and structure |
|---|
| >d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1vhxa_ c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3bexa1 c.55.1.13 (A:1-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hjra_ c.55.3.6 (A:) RuvC resolvase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2f9wa2 c.55.1.13 (A:1-114) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xc3a1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2d0oa2 c.55.1.6 (A:1-92,A:255-403) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} | Back information, alignment and structure |
|---|
| >d1nbwa2 c.55.1.6 (A:2-91,A:257-405) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1sz2a1 c.55.1.7 (A:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1czan3 c.55.1.3 (N:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1v4sa1 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdga1 c.55.1.3 (A:13-222) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} | Back information, alignment and structure |
|---|
| >d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1czan1 c.55.1.3 (N:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z05a3 c.55.1.10 (A:81-208) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1z6ra2 c.55.1.10 (A:82-210) Mlc protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2zgya1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|