Diaphorina citri psyllid: psy17253


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MRREINPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTLEETSK
cccccccccccccccccccEEEEccccccccccHHHHcccccccccEEEccccccccccHHHHccccccEEEEEcccccccccccccccccccccccccccHHHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccccccEEEcccccccccHHHHcccccccEEEcccccccccccccccccccccEEccccccccccccccc
**REINPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLT*L*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRREINPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTLEETSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0051179 [BP]localizationprobableGO:0008150
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0048589 [BP]developmental growthprobableGO:0044767, GO:0032502, GO:0008150, GO:0040007, GO:0044699
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 28-221
View the alignment between query and template
View the model in PyMOL
Template: 2Z66, chain A
Confidence level:very confident
Coverage over the Query: 7-224
View the alignment between query and template
View the model in PyMOL