Psyllid ID: psy17253


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MRREINPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTLEETSK
cccccccccccccccccccEEEEccccccccccHHHHcccccccccEEEccccccccccHHHHccccccEEEEEcccccccccccccccccccccccccccHHHHHcccccccEEEcccccccccHHHHHccccccEEEccccccccccccccccccccccccEEEccccccccHHHHHHccccccEEEcccccccccccccccccccccEEccccccccccccccc
ccccccccEEEccccccccEEEEccccccHHHHHHHcccccccccEEEEEcccccccccHHHHHccccEEEEEEEcccccccccccccccccccccHHHHHHHHHHcccHcccEEEccccccccccHHHcccccccEEEcccccccEcccHHHcccHHHHHHHEEEccccccccccHHHcccccccEEEcccccccEccHHHHcccHcccEEEccccccEEcccccc
mrreinpctckcrtspispivVECEKMTSFGQVVDALQDRFGNDSISLKIAVSnlndlpsktFQELGLQIVNLKltknnlrpdgaalrpidvcappstldnlknQVQGVTNIFELKLQHNeienldgalmgihglsrldlshnklrtispddfigldsvTNIFELKLQHNeienldgalmgihglsrldlshnklrtispddfigldslkmLDISHNLLTTLEETSK
mrreinpctckcrtspispIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHnllttleetsk
MRREINPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTLEETSK
******PCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLT*******
**REINPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNL***L*****
MRREINPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTLEETSK
****INPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRREINPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTLEETSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query227 2.2.26 [Sep-21-2011]
Q66JT1795 Leucine-rich repeat-conta yes N/A 0.744 0.212 0.331 6e-11
P35859 603 Insulin-like growth facto yes N/A 0.506 0.190 0.358 5e-10
Q8BGR2 859 Leucine-rich repeat-conta no N/A 0.511 0.135 0.319 7e-10
P70389 603 Insulin-like growth facto no N/A 0.506 0.190 0.366 8e-10
Q5U308 858 Leucine-rich repeat-conta no N/A 0.511 0.135 0.319 1e-09
Q7L1W4 858 Leucine-rich repeat-conta yes N/A 0.488 0.129 0.324 3e-09
Q6UXM1 1119 Leucine-rich repeats and no N/A 0.779 0.158 0.271 3e-09
Q6R6I6 758 Relaxin receptor 1 OS=Rat no N/A 0.533 0.159 0.365 7e-09
Q5R5V8 757 Relaxin receptor 1 OS=Pon no N/A 0.533 0.159 0.357 9e-09
Q9HBX9 757 Relaxin receptor 1 OS=Hom no N/A 0.533 0.159 0.357 9e-09
>sp|Q66JT1|LRC8E_MOUSE Leucine-rich repeat-containing protein 8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 Back     alignment and function desciption
 Score = 67.8 bits (164), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 61/184 (33%), Positives = 89/184 (48%), Gaps = 15/184 (8%)

Query: 48  LKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQ-- 105
           L++    L  +P   F    LQ ++LK   N+LR     L     C    TL    NQ  
Sbjct: 586 LELVACGLERIPHAIFSLGALQELDLK--DNHLRSIEEILS-FQHCRKLVTLRLWHNQIA 642

Query: 106 -----VQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVT 160
                V+ + ++ +L L HN++E L   L    GL  LDLSHN LR++ P+  +GL  + 
Sbjct: 643 YVPEHVRKLRSLEQLYLSHNKLETLPTQLGQCFGLRLLDLSHNGLRSLPPE--LGL--LQ 698

Query: 161 NIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLT 220
           ++  L L +N +E+L   L   H L  L L +N L  +SP D   L +L  L++  N L 
Sbjct: 699 SLQHLALSYNALESLPDELFFCHKLRTLLLGYNHLTQLSP-DVAALQALSRLELKGNRLE 757

Query: 221 TLEE 224
           TL E
Sbjct: 758 TLPE 761





Mus musculus (taxid: 10090)
>sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 Back     alignment and function description
>sp|Q8BGR2|LRC8D_MOUSE Leucine-rich repeat-containing protein 8D OS=Mus musculus GN=Lrrc8d PE=2 SV=1 Back     alignment and function description
>sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=2 SV=1 Back     alignment and function description
>sp|Q5U308|LRC8D_RAT Leucine-rich repeat-containing protein 8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 Back     alignment and function description
>sp|Q7L1W4|LRC8D_HUMAN Leucine-rich repeat-containing protein 8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 Back     alignment and function description
>sp|Q6UXM1|LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens GN=LRIG3 PE=2 SV=1 Back     alignment and function description
>sp|Q6R6I6|RXFP1_RAT Relaxin receptor 1 OS=Rattus norvegicus GN=Rxfp1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R5V8|RXFP1_PONAB Relaxin receptor 1 OS=Pongo abelii GN=RXFP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9HBX9|RXFP1_HUMAN Relaxin receptor 1 OS=Homo sapiens GN=RXFP1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
242003810 543 leucine-rich transmembrane protein, puta 0.502 0.209 0.449 4e-22
270003207 584 hypothetical protein TcasGA2_TC002411 [T 0.414 0.160 0.555 1e-19
91080065 509 PREDICTED: similar to AGAP005962-PA [Tri 0.308 0.137 0.555 1e-19
193575713 577 PREDICTED: malignant fibrous histiocytom 0.920 0.362 0.338 7e-17
170045937 686 leucine-rich repeat-containing protein 4 0.568 0.188 0.407 8e-16
157115103 630 leucine-rich transmembrane protein [Aede 0.502 0.180 0.384 1e-15
312376719 939 hypothetical protein AND_12362 [Anophele 0.524 0.126 0.377 2e-14
158295080 830 AGAP005962-PA [Anopheles gambiae str. PE 0.854 0.233 0.347 3e-14
194751195 817 GF10651 [Drosophila ananassae] gi|190625 0.876 0.243 0.302 1e-13
357612148 523 putative leucine-rich transmembrane prot 0.568 0.246 0.446 2e-13
>gi|242003810|ref|XP_002422869.1| leucine-rich transmembrane protein, putative [Pediculus humanus corporis] gi|212505751|gb|EEB10131.1| leucine-rich transmembrane protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 88/138 (63%), Gaps = 24/138 (17%)

Query: 114 ELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSV-------------- 159
           +++L HN ++NL+ A + +  L  L+L+HN L   S  +  GL ++              
Sbjct: 211 DIQLGHNHLKNLNRAFLPMRRLRSLNLTHNLLEEFSFQEIRGLQNLKIVDLSFNKISQLN 270

Query: 160 ----------TNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSL 209
                     T + EL+L+HNEI+ L+G+LMGIHGL +L+LSHNKL TI+PDDFIGL+ L
Sbjct: 271 GKMENLVELETRVEELRLEHNEIKALEGSLMGIHGLQKLNLSHNKLMTIAPDDFIGLEDL 330

Query: 210 KMLDISHNLLTTLEETSK 227
            +LDIS+NLL TL+ETSK
Sbjct: 331 TILDISYNLLQTLDETSK 348




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270003207|gb|EEZ99654.1| hypothetical protein TcasGA2_TC002411 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91080065|ref|XP_966986.1| PREDICTED: similar to AGAP005962-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193575713|ref|XP_001949578.1| PREDICTED: malignant fibrous histiocytoma-amplified sequence 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|170045937|ref|XP_001850546.1| leucine-rich repeat-containing protein 40 [Culex quinquefasciatus] gi|167868779|gb|EDS32162.1| leucine-rich repeat-containing protein 40 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157115103|ref|XP_001658113.1| leucine-rich transmembrane protein [Aedes aegypti] gi|108877017|gb|EAT41242.1| AAEL007087-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312376719|gb|EFR23726.1| hypothetical protein AND_12362 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158295080|ref|XP_316002.4| AGAP005962-PA [Anopheles gambiae str. PEST] gi|157015864|gb|EAA11826.4| AGAP005962-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|194751195|ref|XP_001957912.1| GF10651 [Drosophila ananassae] gi|190625194|gb|EDV40718.1| GF10651 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|357612148|gb|EHJ67839.1| putative leucine-rich transmembrane protein [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
FB|FBgn0033250 470 CG14762 [Drosophila melanogast 0.929 0.448 0.313 8.3e-17
FB|FBgn0052372 817 ltl "larval translucida" [Dros 0.916 0.254 0.256 1.1e-12
UNIPROTKB|F1NI07 604 IGFALS "Uncharacterized protei 0.757 0.284 0.320 2.3e-12
UNIPROTKB|F1MJZ4 610 IGFALS "Uncharacterized protei 0.731 0.272 0.329 3e-12
MGI|MGI:1919517795 Lrrc8e "leucine rich repeat co 0.744 0.212 0.331 5.8e-12
UNIPROTKB|Q1KS52 606 ALS "Acid-labile subunit" [Sus 0.691 0.259 0.335 6.3e-12
UNIPROTKB|F1PLN5376 FMOD "Uncharacterized protein" 0.885 0.534 0.313 6.6e-12
MGI|MGI:2144814 719 Lrfn5 "leucine rich repeat and 0.837 0.264 0.285 1.3e-11
RGD|1309357 719 Lrfn5 "leucine rich repeat and 0.837 0.264 0.285 1.3e-11
UNIPROTKB|P35858 605 IGFALS "Insulin-like growth fa 0.722 0.271 0.320 1.7e-11
FB|FBgn0033250 CG14762 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 214 (80.4 bits), Expect = 8.3e-17, P = 8.3e-17
 Identities = 72/230 (31%), Positives = 114/230 (49%)

Query:     4 EINPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSIS--LKIAVSNLNDLPSK 61
             EI PC C  + + +    + CE  T    +  ++    G   I   LK+  +NL  L   
Sbjct:    44 EIAPCICTVKKNGLD---ILCET-TDLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGF 99

Query:    62 TFQELGLQ---IVNLKLT---KNNLRPDGAALRPIDVCAPPSTLDNLKNQ-VQGVTNIFE 114
              F  L ++   I N  L    +N L   GA L  +DV    + +  + +Q +Q + ++  
Sbjct:   100 VFLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSL--NQMKTVPSQALQHLFHLLI 157

Query:   115 LKLQHNEIENL-DGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIE 173
             L L HN+I  + + A  G+  L  L L  NK+  I P+ F GL+   +I  L L  N++ 
Sbjct:   158 LNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLED--HIKRLNLGGNDLT 215

Query:   174 NL-DGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTL 222
             N+   AL  +  L +L++  NK+RTIS  DF GL SL  L ++HN++TT+
Sbjct:   216 NIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTV 265


GO:0048812 "neuron projection morphogenesis" evidence=IMP
FB|FBgn0052372 ltl "larval translucida" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NI07 IGFALS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MJZ4 IGFALS "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1919517 Lrrc8e "leucine rich repeat containing 8 family, member E" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KS52 ALS "Acid-labile subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLN5 FMOD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2144814 Lrfn5 "leucine rich repeat and fibronectin type III domain containing 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309357 Lrfn5 "leucine rich repeat and fibronectin type III domain containing 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P35858 IGFALS "Insulin-like growth factor-binding protein complex acid labile subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-06
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-04
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 53.7 bits (130), Expect = 4e-10
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 164 ELKLQHNEIENL-DGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLL 219
            L L +N +  + DGA  G+  L  LDLS N L +ISP+ F GL SL+ LD+S N L
Sbjct: 4   SLDLSNNRLTVIPDGAFKGLPNLKVLDLSGNNLTSISPEAFSGLPSLRSLDLSGNNL 60


Length = 60

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 227
KOG4237|consensus 498 99.83
KOG4194|consensus 873 99.82
KOG4194|consensus 873 99.77
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.72
KOG0617|consensus264 99.68
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.65
KOG0444|consensus 1255 99.65
KOG0472|consensus 565 99.61
KOG4237|consensus 498 99.58
KOG0472|consensus565 99.56
KOG0444|consensus 1255 99.55
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.55
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.46
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.45
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.44
KOG0618|consensus 1081 99.43
KOG0532|consensus 722 99.42
KOG0617|consensus264 99.39
KOG0618|consensus 1081 99.35
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.28
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.23
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.15
KOG0532|consensus 722 99.11
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.07
KOG1259|consensus490 99.07
KOG1259|consensus490 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.05
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.03
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.01
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.91
KOG3207|consensus 505 98.88
PLN03150623 hypothetical protein; Provisional 98.88
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.82
KOG3207|consensus 505 98.78
KOG1859|consensus 1096 98.67
PLN03150 623 hypothetical protein; Provisional 98.56
KOG1909|consensus 382 98.45
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.41
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.37
KOG0531|consensus 414 98.37
KOG4579|consensus177 98.31
KOG1909|consensus 382 98.29
KOG0531|consensus 414 98.29
KOG1644|consensus233 98.28
KOG1644|consensus233 98.25
KOG4579|consensus177 98.21
KOG1859|consensus 1096 98.15
KOG4658|consensus 889 98.11
KOG2982|consensus 418 97.96
PRK15386 426 type III secretion protein GogB; Provisional 97.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.66
KOG3665|consensus 699 97.64
KOG4658|consensus 889 97.52
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.47
KOG3665|consensus 699 97.44
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.27
KOG2739|consensus260 97.2
KOG2120|consensus419 97.2
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.11
PRK15386 426 type III secretion protein GogB; Provisional 97.1
KOG2982|consensus 418 97.01
KOG2123|consensus 388 96.99
KOG2739|consensus 260 96.6
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.48
KOG2120|consensus419 96.34
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.18
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.72
KOG2123|consensus 388 95.28
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.27
smart0037026 LRR Leucine-rich repeats, outliers. 95.27
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.62
smart0037026 LRR Leucine-rich repeats, outliers. 93.62
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 92.06
KOG0473|consensus 326 91.06
KOG3864|consensus221 89.13
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 85.07
KOG4308|consensus 478 84.91
KOG3864|consensus221 84.82
KOG3763|consensus 585 84.0
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.55
>KOG4237|consensus Back     alignment and domain information
Probab=99.83  E-value=2.2e-21  Score=153.24  Aligned_cols=213  Identities=23%  Similarity=0.440  Sum_probs=145.4

Q ss_pred             CCCccccccCCCCCceEEEecCCCCccchhhcccCCCCCCccEEEeCCCCCCCCChhhhhcccccccEEEccCCCCCC-C
Q psy17253          5 INPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRP-D   83 (227)
Q Consensus         5 ~~~~~c~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~l~~~~~~~~~~~~~~L~~L~l~~n~~~~-~   83 (227)
                      ++|.+|+|.++.  +..|.|..     +.+..+|..+++..+.+++..|.|+.+|+.+|+.++ +|+.||+++|.|+. .
T Consensus        36 ~CP~pC~Cs~~~--g~~VdCr~-----~GL~eVP~~LP~~tveirLdqN~I~~iP~~aF~~l~-~LRrLdLS~N~Is~I~  107 (498)
T KOG4237|consen   36 ACPAPCTCSDVE--GGIVDCRG-----KGLTEVPANLPPETVEIRLDQNQISSIPPGAFKTLH-RLRRLDLSKNNISFIA  107 (498)
T ss_pred             cCCCCcccCCCC--CceEEccC-----CCcccCcccCCCcceEEEeccCCcccCChhhccchh-hhceecccccchhhcC
Confidence            567779998543  67899988     778888999999999999999999999999999998 99999999999999 8


Q ss_pred             CCCC------------CCCCCCCCcc-hhhchhhhhc-----------------CCCcccEEEccCCCcccccc-cccCC
Q psy17253         84 GAAL------------RPIDVCAPPS-TLDNLKNQVQ-----------------GVTNIFELKLQHNEIENLDG-ALMGI  132 (227)
Q Consensus        84 ~~~~------------~~~~l~~~~~-~~~~~~~~~~-----------------~l~~L~~L~l~~n~l~~l~~-~~~~l  132 (227)
                      +.+|            .+|++..+|. .+.++.....                 .++++..|.+.+|.++.++. +|..+
T Consensus       108 p~AF~GL~~l~~Lvlyg~NkI~~l~k~~F~gL~slqrLllNan~i~Cir~~al~dL~~l~lLslyDn~~q~i~~~tf~~l  187 (498)
T KOG4237|consen  108 PDAFKGLASLLSLVLYGNNKITDLPKGAFGGLSSLQRLLLNANHINCIRQDALRDLPSLSLLSLYDNKIQSICKGTFQGL  187 (498)
T ss_pred             hHhhhhhHhhhHHHhhcCCchhhhhhhHhhhHHHHHHHhcChhhhcchhHHHHHHhhhcchhcccchhhhhhccccccch
Confidence            8888            5588888886 3444433222                 47788888888887766543 55555


Q ss_pred             CCCCEEEcCCCcC-cc-----------cCCCCCCCCC-------------------------------------------
Q psy17253        133 HGLSRLDLSHNKL-RT-----------ISPDDFIGLD-------------------------------------------  157 (227)
Q Consensus       133 ~~L~~L~l~~n~l-~~-----------~~~~~~~~~~-------------------------------------------  157 (227)
                      .+++.+.+..|.+ ..           ..+-.+++..                                           
T Consensus       188 ~~i~tlhlA~np~icdCnL~wla~~~a~~~ietsgarc~~p~rl~~~Ri~q~~a~kf~c~~esl~s~~~~~d~~d~~cP~  267 (498)
T KOG4237|consen  188 AAIKTLHLAQNPFICDCNLPWLADDLAMNPIETSGARCVSPYRLYYKRINQEDARKFLCSLESLPSRLSSEDFPDSICPA  267 (498)
T ss_pred             hccchHhhhcCccccccccchhhhHHhhchhhcccceecchHHHHHHHhcccchhhhhhhHHhHHHhhccccCcCCcChH
Confidence            5555555544441 00           0000000000                                           


Q ss_pred             ----CCCcccEEEcCCCCCcCch-hhhcCCCCCCEEeCCCCccccCCccccCCCCCCCEEEcCCCcCcccCCC
Q psy17253        158 ----SVTNIFELKLQHNEIENLD-GALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTLEET  225 (227)
Q Consensus       158 ----~~~~L~~l~l~~n~~~~~~-~~~~~~~~L~~l~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~lp~~  225 (227)
                          .+++|+.+++++|+++.+. .++.+...++.|.+..|++..+...+|.++..|+.|+|.+|+++.+.++
T Consensus       268 ~cf~~L~~L~~lnlsnN~i~~i~~~aFe~~a~l~eL~L~~N~l~~v~~~~f~~ls~L~tL~L~~N~it~~~~~  340 (498)
T KOG4237|consen  268 KCFKKLPNLRKLNLSNNKITRIEDGAFEGAAELQELYLTRNKLEFVSSGMFQGLSGLKTLSLYDNQITTVAPG  340 (498)
T ss_pred             HHHhhcccceEeccCCCccchhhhhhhcchhhhhhhhcCcchHHHHHHHhhhccccceeeeecCCeeEEEecc
Confidence                2445666666666666664 4556666666666666666666555666666666666666666665544



>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-07
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 3e-07
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 7e-07
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 2e-06
3vq1_A 606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 4e-06
2z64_A 599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 4e-06
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 5e-06
3rfj_A 279 Design Of A Binding Scaffold Based On Variable Lymp 7e-06
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 1e-05
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 2e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 3e-05
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 4e-05
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 4e-05
3zyo_A 411 Crystal Structure Of The N-Terminal Leucine Rich Re 4e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 4e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 5e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 5e-05
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 6e-05
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 7e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 8e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 9e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 9e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-04
3oja_B 597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 1e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 2e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-04
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 3e-04
3a79_A 580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 4e-04
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 4e-04
2z81_A 549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 4e-04
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 5e-04
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 5e-04
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Iteration: 1

Score = 52.0 bits (123), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 39/120 (32%), Positives = 71/120 (59%), Gaps = 5/120 (4%) Query: 106 VQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFEL 165 +Q + N+ L L N++ ++ AL + L+ L L+ N+L+++ F D +TN+ EL Sbjct: 59 IQYLPNVRYLALGGNKLHDI-SALKELTNLTYLILTGNQLQSLPNGVF---DKLTNLKEL 114 Query: 166 KLQHNEIENL-DGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTLEE 224 L N++++L DG + L+ L+L+HN+L+++ F L +L LD+S+N L +L E Sbjct: 115 VLVENQLQSLPDGVFDKLTNLTYLNLAHNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPE 174
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-24
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-24
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-23
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-23
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-23
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-22
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-19
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-19
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-21
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-21
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-20
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-19
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-13
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-19
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-16
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 6e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-18
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-18
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-16
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 3e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-16
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-16
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 4e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-14
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 8e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-13
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-12
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-12
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-14
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 4e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-13
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 4e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 7e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-08
3m19_A 251 Variable lymphocyte receptor A diversity region; a 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-07
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 8e-07
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 6e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
3e6j_A 229 Variable lymphocyte receptor diversity region; var 6e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-04
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
 Score = 98.5 bits (246), Expect = 5e-25
 Identities = 43/221 (19%), Positives = 77/221 (34%), Gaps = 30/221 (13%)

Query: 7   PCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQEL 66
           PC   C       +   C       Q + A+       S  + +  + ++ +P+ +F+  
Sbjct: 1   PCPGACVCYNEPKVTTSCP-----QQGLQAVPVGIPAASQRIFLHGNRISHVPAASFRAC 55

Query: 67  GLQIVNLKLTKNNLRPDGAALRPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNE-IENL 125
              +  L L  N L                +    L         + +L L  N  + ++
Sbjct: 56  R-NLTILWLHSNVLA-----------RIDAAAFTGL-------ALLEQLDLSDNAQLRSV 96

Query: 126 -DGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENL-DGALMGIH 183
                 G+  L  L L    L+ + P  F GL     +  L LQ N ++ L D     + 
Sbjct: 97  DPATFHGLGRLHTLHLDRCGLQELGPGLFRGL---AALQYLYLQDNALQALPDDTFRDLG 153

Query: 184 GLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTLEE 224
            L+ L L  N++ ++    F GL SL  L +  N +  +  
Sbjct: 154 NLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHP 194


>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.89
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.87
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.87
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.87
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.86
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.82
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.81
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.8
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.8
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.8
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.79
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.79
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.78
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.78
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.78
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.76
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.76
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.76
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.76
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.75
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.73
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.73
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.73
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.73
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.72
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.72
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.71
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.7
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.69
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.67
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.65
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.65
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.64
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.63
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.59
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.58
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.56
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.54
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.54
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.53
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.51
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.51
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.47
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.46
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.36
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.34
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.34
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.34
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.29
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.22
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.08
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.02
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.75
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.69
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.62
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.6
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.47
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.3
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.26
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.2
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.0
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.0
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.96
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.8
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.77
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.72
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.68
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.63
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.45
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
Probab=99.92  E-value=1.9e-23  Score=163.69  Aligned_cols=197  Identities=26%  Similarity=0.458  Sum_probs=135.4

Q ss_pred             CCccccccCCCCCceEEEecCCCCccchhhcccCCCCCCccEEEeCCCCCCCCChhhhhcccccccEEEccCCCCCC-CC
Q psy17253          6 NPCTCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRP-DG   84 (227)
Q Consensus         6 ~~~~c~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~l~~~~~~~~~~~~~~L~~L~l~~n~~~~-~~   84 (227)
                      .+..|.|....   ..+.|..     .-...+|..++.+++.|++++|.+..++..+|..++ +|+.|++++|.+.. +.
T Consensus         8 ~~~~C~c~~~~---~~l~~~~-----~~l~~ip~~~~~~l~~L~l~~n~l~~~~~~~~~~l~-~L~~L~l~~n~l~~i~~   78 (270)
T 2o6q_A            8 DGGVCSCNNNK---NSVDCSS-----KKLTAIPSNIPADTKKLDLQSNKLSSLPSKAFHRLT-KLRLLYLNDNKLQTLPA   78 (270)
T ss_dssp             GTCSBEEETTT---TEEECTT-----SCCSSCCSCCCTTCSEEECCSSCCSCCCTTSSSSCT-TCCEEECCSSCCSCCCT
T ss_pred             CCCCCEeCCCC---CEEEccC-----CCCCccCCCCCCCCCEEECcCCCCCeeCHHHhcCCC-CCCEEECCCCccCeeCh
Confidence            33446665321   2688866     223345666667899999999999999998899998 99999999999988 76


Q ss_pred             CCCC-----------CCCCCCCcchhhchhhhhcCCCcccEEEccCCCccccc-ccccCCCCCCEEEcCCCcCcccCCCC
Q psy17253         85 AALR-----------PIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLD-GALMGIHGLSRLDLSHNKLRTISPDD  152 (227)
Q Consensus        85 ~~~~-----------~~~l~~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~l~-~~~~~l~~L~~L~l~~n~l~~~~~~~  152 (227)
                      ..|.           .+.+..++.      ..+.++++|+.|++++|.++.++ ..|..+++|+.|++++|.++.+++..
T Consensus        79 ~~~~~l~~L~~L~l~~n~l~~~~~------~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~  152 (270)
T 2o6q_A           79 GIFKELKNLETLWVTDNKLQALPI------GVFDQLVNLAELRLDRNQLKSLPPRVFDSLTKLTYLSLGYNELQSLPKGV  152 (270)
T ss_dssp             TTTSSCTTCCEEECCSSCCCCCCT------TTTTTCSSCCEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCCCCCTTT
T ss_pred             hhhcCCCCCCEEECCCCcCCcCCH------hHcccccCCCEEECCCCccCeeCHHHhCcCcCCCEEECCCCcCCccCHhH
Confidence            6652           233333332      12334567777777777777763 34566777777777777777666555


Q ss_pred             CCCCCCCCcccEEEcCCCCCcCch-hhhcCCCCCCEEeCCCCccccCCccccCCCCCCCEEEcCCCcCc
Q psy17253        153 FIGLDSVTNIFELKLQHNEIENLD-GALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLT  220 (227)
Q Consensus       153 ~~~~~~~~~L~~l~l~~n~~~~~~-~~~~~~~~L~~l~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~  220 (227)
                      +..+++   |+.|++++|.++.++ ..+..+++|+.|++++|+++.+.+..+..+++|+.|++++|++.
T Consensus       153 ~~~l~~---L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~N~~~  218 (270)
T 2o6q_A          153 FDKLTS---LKELRLYNNQLKRVPEGAFDKLTELKTLKLDNNQLKRVPEGAFDSLEKLKMLQLQENPWD  218 (270)
T ss_dssp             TTTCTT---CCEEECCSSCCSCCCTTTTTTCTTCCEEECCSSCCSCCCTTTTTTCTTCCEEECCSSCBC
T ss_pred             ccCCcc---cceeEecCCcCcEeChhHhccCCCcCEEECCCCcCCcCCHHHhccccCCCEEEecCCCee
Confidence            544444   777777777777665 34566677777777777777776666777777777777777654



>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 227
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.004
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-05
d1a9na_ 162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 52.7 bits (125), Expect = 8e-09
 Identities = 18/88 (20%), Positives = 40/88 (45%), Gaps = 8/88 (9%)

Query: 130 MGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKLQHNEIENLDGALMGIHGLSRLD 189
             +  L+ L L  N +  ISP     + S+T +  L   +N++ ++  +L  +  ++ L 
Sbjct: 304 SNLKNLTYLTLYFNNISDISP-----VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLS 357

Query: 190 LSHNKLRTISPDDFIGLDSLKMLDISHN 217
             HN++  ++P     L  +  L ++  
Sbjct: 358 AGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.77
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.6
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.58
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.57
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.48
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.46
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.95
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.88
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.87
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.81
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.81
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.41
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.2
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.09
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.05
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=1.5e-24  Score=167.87  Aligned_cols=186  Identities=25%  Similarity=0.377  Sum_probs=135.8

Q ss_pred             cccccCCCCCceEEEecCCCCccchhhcccCCCCCCccEEEeCCCCCCCCChhhhhcccccccEEEccCCCCCC-CCCCC
Q psy17253          9 TCKCRTSPISPIVVECEKMTSFGQVVDALQDRFGNDSISLKIAVSNLNDLPSKTFQELGLQIVNLKLTKNNLRP-DGAAL   87 (227)
Q Consensus         9 ~c~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~l~~~~~~~~~~~~~~L~~L~l~~n~~~~-~~~~~   87 (227)
                      .|.|. ...+.++|.|.+.    ++ ..+|..++.++++|++++|.|..++..+|..++ +|+.|++++|+++. +... 
T Consensus         3 ~C~~~-~~~~~~~v~C~~~----~L-~~iP~~lp~~l~~L~Ls~N~i~~l~~~~f~~l~-~L~~L~L~~N~l~~l~~~~-   74 (266)
T d1p9ag_           3 ICEVS-KVASHLEVNCDKR----NL-TALPPDLPKDTTILHLSENLLYTFSLATLMPYT-RLTQLNLDRAELTKLQVDG-   74 (266)
T ss_dssp             SSEEE-CSTTCCEEECTTS----CC-SSCCSCCCTTCCEEECTTSCCSEEEGGGGTTCT-TCCEEECTTSCCCEEECCS-
T ss_pred             ccEEc-ccCCCeEEEccCC----CC-CeeCcCcCcCCCEEECcCCcCCCcCHHHhhccc-ccccccccccccccccccc-
Confidence            46665 4455578999772    33 345667777899999999999999999999998 99999999999886 4322 


Q ss_pred             CCCCCCCCcchhhchhhhhcCCCcccEEEccCCCcccccccccCCCCCCEEEcCCCcCcccCCCCCCCCCCCCcccEEEc
Q psy17253         88 RPIDVCAPPSTLDNLKNQVQGVTNIFELKLQHNEIENLDGALMGIHGLSRLDLSHNKLRTISPDDFIGLDSVTNIFELKL  167 (227)
Q Consensus        88 ~~~~l~~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~l~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~L~~l~l  167 (227)
                                          .+++|+.|++++|+++..+..+..+++|+.|++++|.+..+....+..+.+   ++.+++
T Consensus        75 --------------------~l~~L~~L~Ls~N~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~---l~~L~l  131 (266)
T d1p9ag_          75 --------------------TLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGE---LQELYL  131 (266)
T ss_dssp             --------------------CCTTCCEEECCSSCCSSCCCCTTTCTTCCEEECCSSCCCCCCSSTTTTCTT---CCEEEC
T ss_pred             --------------------ccccccccccccccccccccccccccccccccccccccceeeccccccccc---cccccc
Confidence                                246677777777777777666777777777777777776666555544444   777777


Q ss_pred             CCCCCcCch-hhhcCCCCCCEEeCCCCccccCCccccCCCCCCCEEEcCCCcCcccCCC
Q psy17253        168 QHNEIENLD-GALMGIHGLSRLDLSHNKLRTISPDDFIGLDSLKMLDISHNLLTTLEET  225 (227)
Q Consensus       168 ~~n~~~~~~-~~~~~~~~L~~l~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~lp~~  225 (227)
                      ++|.++.++ ..+..+..++.+++++|+++.+.+..|..+++|+.|++++|.++++|++
T Consensus       132 ~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~~L~~L~Ls~N~L~~lp~~  190 (266)
T d1p9ag_         132 KGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKG  190 (266)
T ss_dssp             TTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCTTCCEEECCSSCCCCCCTT
T ss_pred             cccccceeccccccccccchhcccccccccccCccccccccccceeecccCCCcccChh
Confidence            777777665 3345566777777777777777666777777777777777777777764



>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure