Diaphorina citri psyllid: psy17256

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------77

GADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGFGADSTDHTDSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKMKSSQNRPKYGYYPEPNKSFLVIKPQFLEEASLLFHDLHVQIVTEKRFLGGVIGNGDEKKNYVKEKVNQWIDCVKKLSEAAKKSPQAAFSVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVPSIFEHEISSSEHELFHLPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQEHNQCVKNAINTELVRKETEYQEKQERILSSLPPAKQRVLTRIVEGQSSHWLNVIPKSSDNFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDECIMMASYAWNGIVKEPIMRDSSSTSPALIADFKINGVWEAGGTAFFDNRIVNADAPSYSSQTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHYLELVDGGTTSSDDGADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKMKSSQN

cccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccEEEEcccHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHcccccccEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccHHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccEEcccccccEEEEcccHHHHHHHHHHHHHcccccccccccccccccccHHHHcccccccccccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHEEEEEEEEHHHHcccccccccccccccccccccccEEEEcccccccEEEEEEEcccccccccccccccccEEEcccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHccccccccccccc

*******************************************************************TEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRAR**********************************QFLEEASLLFHDLHVQIVTEKRFLGGVIGNGDEKKNYVKEKVNQWIDCVKKLS***********SVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVPSIFEHEISSSEHELFHLPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQEHNQCVKNAINTELVRKETEYQEKQERILSSLPPAK*RVLTRIVEGQSSHWLNVIPKSSDNFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDECIMMASYAWNGIVKEPIMRD*****PALIADFKINGVWEAGGTAFFDNRIVNADAPSYSSQTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHYLELVDGGT*******************************************D**DLERIAQITGLSKRVTQVWFQNS******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

GADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGFGADSTDHTDSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKMKSSQNRPKYGYYPEPNKSFLVIKPQFLEEASLLFHDLHVQIVTEKRFLGGVIGNGDEKKNYVKEKVNQWIDCVKKLSEAAKKSPQAAFSVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVPSIFEHEISSSEHELFHLPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQEHNQCVxxxxxxxxxxxxxxxxxxxxxILSSLPPAKQRVLTRIVEGQSSHWLNVIPKSSDNFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDECIMMASYAWNGIVKEPIMRDSSSTSPALIADFKINGVWEAGGTAFFDNRIVNADAPSYSSQTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHYLELVDGGTTSSDDGADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKMKSSQN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
LIM/homeobox protein Awh	Probable transcription factor. Required for the establishment of a subset of imaginal tissues: the abdominal histoblasts and the salivary gland imaginal rings.	confident	Q8IRC7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0007444 [BP]	imaginal disc development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0030154 [BP]	cell differentiation	probable	GO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RGT, chain A
Confidence level:very confident
Coverage over the Query: 531-573,592-678,702-727
View the alignment between query and template
View the model in PyMOL

Template: 2DA2, chain A
Confidence level:very confident
Coverage over the Query: 704-760
View the alignment between query and template
View the model in PyMOL

Template: 2DA2, chain A
Confidence level:very confident
Coverage over the Query: 65-120
View the alignment between query and template
View the model in PyMOL

Template: 1AU7, chain A
Confidence level:very confident
Coverage over the Query: 26-37,62-118
View the alignment between query and template
View the model in PyMOL