Psyllid ID: psy17256
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 768 | ||||||
| 340384014 | 1577 | PREDICTED: hypothetical protein LOC10063 | 0.601 | 0.292 | 0.390 | 5e-94 | |
| 340383257 | 938 | PREDICTED: hypothetical protein LOC10063 | 0.533 | 0.437 | 0.389 | 1e-78 | |
| 91078266 | 343 | PREDICTED: similar to GA10520-PA [Tribol | 0.197 | 0.443 | 0.882 | 1e-73 | |
| 270004863 | 349 | arrowhead [Tribolium castaneum] | 0.197 | 0.435 | 0.882 | 2e-73 | |
| 379698940 | 274 | arrowhead PA [Bombyx mori] gi|346223348| | 0.200 | 0.562 | 0.864 | 5e-72 | |
| 357605400 | 406 | hypothetical protein KGM_21596 [Danaus p | 0.200 | 0.379 | 0.841 | 2e-70 | |
| 195125467 | 239 | GI12512 [Drosophila mojavensis] gi|19391 | 0.196 | 0.631 | 0.809 | 1e-67 | |
| 195375542 | 239 | GJ12418 [Drosophila virilis] gi|19415371 | 0.196 | 0.631 | 0.809 | 1e-67 | |
| 195441498 | 275 | GK20529 [Drosophila willistoni] gi|19416 | 0.213 | 0.596 | 0.754 | 1e-67 | |
| 195016322 | 239 | GH16430 [Drosophila grimshawi] gi|193897 | 0.196 | 0.631 | 0.809 | 2e-67 |
| >gi|340384014|ref|XP_003390510.1| PREDICTED: hypothetical protein LOC100638826 [Amphimedon queenslandica] | Back alignment and taxonomy information |
|---|
Score = 352 bits (903), Expect = 5e-94, Method: Compositional matrix adjust.
Identities = 181/464 (39%), Positives = 269/464 (57%), Gaps = 2/464 (0%)
Query: 131 PKYGYYPEPNKSFLVIKPQFLEEASLLFHDLHVQIVTEKRFLGGVIGNGDEKKNYVKEKV 190
P +GY+PEP+K L++ L+ A LLF D V IV + +FLGGVIGN + +++ K
Sbjct: 1108 PLFGYFPEPSKCHLIVSESNLDNARLLFRDTGVNIVKDGKFLGGVIGNKVARDSFISSKS 1167
Query: 191 NQWIDCVKKLSEAAKKSPQAAFSVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVP 250
+W +++LS PQ+A+ V++K+LQ EW +LQR+++ C + + I + +P
Sbjct: 1168 EKWSGYIRQLSSLCVSEPQSAYIVLSKALQYEWIYLQRIMSDCGGLFNDVTHDIAHSFLP 1227
Query: 251 SIFEHEISSSEHELFHLPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQ 310
S+F +S SE F LP R GGL I DP T+ ++A + + LV+++ +
Sbjct: 1228 SLFGCGVSESERLFFSLPIRMGGLNIKDPTVTSSFSYAASRDATSYLVNAIKNNLDFESE 1287
Query: 311 EHNQCVKNAINTELVRKETEYQEKQERILSSLPPAKQRVLTRIVEGQSSHWLNVIPKSSD 370
HN CV + + ++ ++ E I++ P +R L + + S+ WL+V P + D
Sbjct: 1288 AHNDCVHASRLSAYNASTSQSEQLYENIMTDASPMLKRTLQKARDCLSA-WLSVPPIAKD 1346
Query: 371 NFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDEC 430
NFDLS +FRD LALRY L LP CDGCG E SVTHAL+C+KGGLV H+ +RD
Sbjct: 1347 NFDLSANEFRDGLALRYGKPLLQLPPTCDGCGSEFSVTHALDCRKGGLVVQRHNEIRDMI 1406
Query: 431 IMMASYAWNGIVKEPIMRDSS-STSPALIADFKINGVWEAGGTAFFDNRIVNADAPSYSS 489
+AS W +VKEP++ DSS S + L+AD I GVW+ TA FD R+V+ DA SY
Sbjct: 1407 CSLASIVWGQVVKEPVVSDSSASDTGGLVADIAIRGVWQRQATALFDVRVVDTDAKSYLR 1466
Query: 490 QTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWK 549
Q+ ++ +EK KY+ A SFTPL S DG + E +FL R+ L+ KW+
Sbjct: 1467 QSPQSVLATAEREKKRKYSAACTARHVSFTPLCFSVDGLMGSETKTFLDRLGDHLASKWE 1526
Query: 550 KMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGL 593
+ Y V+ WLRV+ ++L+A L LRGTR ++P +D A +
Sbjct: 1527 RPYSVVVHWLRVKMSMALLRATDLCLRGTRSKLRPMLIEDDAPI 1570
|
Source: Amphimedon queenslandica Species: Amphimedon queenslandica Genus: Amphimedon Family: Niphatidae Order: Haplosclerida Class: Demospongiae Phylum: Porifera Superkingdom: Eukaryota |
| >gi|340383257|ref|XP_003390134.1| PREDICTED: hypothetical protein LOC100637810, partial [Amphimedon queenslandica] | Back alignment and taxonomy information |
|---|
| >gi|91078266|ref|XP_971202.1| PREDICTED: similar to GA10520-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270004863|gb|EFA01311.1| arrowhead [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|379698940|ref|NP_001243941.1| arrowhead PA [Bombyx mori] gi|346223348|dbj|BAK78925.1| arrowhead PA [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|357605400|gb|EHJ64588.1| hypothetical protein KGM_21596 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|195125467|ref|XP_002007199.1| GI12512 [Drosophila mojavensis] gi|193918808|gb|EDW17675.1| GI12512 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|195375542|ref|XP_002046559.1| GJ12418 [Drosophila virilis] gi|194153717|gb|EDW68901.1| GJ12418 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195441498|ref|XP_002068546.1| GK20529 [Drosophila willistoni] gi|194164631|gb|EDW79532.1| GK20529 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195016322|ref|XP_001984389.1| GH16430 [Drosophila grimshawi] gi|193897871|gb|EDV96737.1| GH16430 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 768 | ||||||
| FB|FBgn0013751 | 275 | Awh "Arrowhead" [Drosophila me | 0.196 | 0.549 | 0.730 | 2.8e-57 | |
| WB|WBGene00002987 | 355 | lim-4 [Caenorhabditis elegans | 0.175 | 0.380 | 0.625 | 4.6e-43 | |
| ZFIN|ZDB-GENE-041025-1 | 375 | lhx6 "LIM homeobox 6" [Danio r | 0.195 | 0.4 | 0.531 | 2.7e-38 | |
| UNIPROTKB|E2REU0 | 379 | LHX8 "Uncharacterized protein" | 0.201 | 0.408 | 0.512 | 5.9e-38 | |
| UNIPROTKB|J9PBA6 | 295 | LHX8 "Uncharacterized protein" | 0.201 | 0.525 | 0.512 | 5.9e-38 | |
| UNIPROTKB|E9PGE3 | 346 | LHX8 "LIM/homeobox protein Lhx | 0.201 | 0.447 | 0.512 | 5.9e-38 | |
| UNIPROTKB|Q68G74 | 356 | LHX8 "LIM/homeobox protein Lhx | 0.201 | 0.435 | 0.512 | 5.9e-38 | |
| UNIPROTKB|C8YLT4 | 295 | Lhx8 "LIM homeobox 8" [Sus scr | 0.201 | 0.525 | 0.512 | 5.9e-38 | |
| UNIPROTKB|F1P4G9 | 347 | LHX8 "Uncharacterized protein" | 0.191 | 0.423 | 0.532 | 7.5e-38 | |
| UNIPROTKB|F1NLU0 | 354 | F1NLU0 "Uncharacterized protei | 0.194 | 0.420 | 0.528 | 9.7e-38 |
| FB|FBgn0013751 Awh "Arrowhead" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 589 (212.4 bits), Expect = 2.8e-57, P = 2.8e-57
Identities = 111/152 (73%), Positives = 125/152 (82%)
Query: 613 RSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSH 672
++FGAKCSKCCRGI++SDWVR+AR+ V+HLACFAC+ C RQLSTGE+FAL +DRVLCK+H
Sbjct: 63 KNFGAKCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAH 122
Query: 673 YLELVXXXXXXXXXXXXXXXXXXKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERI 732
YLE V KSK KRVRTTFTEEQLQVLQANFQ+DSNPDGQDLERI
Sbjct: 123 YLETVEGGTTSSDEGCDGDGYH-KSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERI 181
Query: 733 AQITGLSKRVTQVWFQNSRARQKKHLHTGKMK 764
A +TGLSKRVTQVWFQNSRARQKKH+H GK K
Sbjct: 182 ASVTGLSKRVTQVWFQNSRARQKKHIHAGKNK 213
|
|
| WB|WBGene00002987 lim-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041025-1 lhx6 "LIM homeobox 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2REU0 LHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9PBA6 LHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PGE3 LHX8 "LIM/homeobox protein Lhx8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q68G74 LHX8 "LIM/homeobox protein Lhx8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C8YLT4 Lhx8 "LIM homeobox 8" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4G9 LHX8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLU0 F1NLU0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 768 | |||
| cd09379 | 55 | cd09379, LIM2_AWH, The second LIM domain of Arrowh | 2e-35 | |
| cd09383 | 55 | cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of | 7e-23 | |
| cd09382 | 55 | cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 | 4e-22 | |
| cd09377 | 59 | cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of | 5e-20 | |
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 9e-20 | |
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 9e-20 | |
| cd09376 | 56 | cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of | 1e-19 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 9e-18 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 9e-18 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 2e-17 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 2e-17 | |
| cd09375 | 56 | cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of | 5e-17 | |
| cd09374 | 55 | cd09374, LIM2_Isl, The second LIM domain of Isl, a | 1e-16 | |
| cd09472 | 57 | cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3 | 2e-16 | |
| cd09473 | 56 | cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 | 7e-16 | |
| cd09471 | 55 | cd09471, LIM2_Isl2, The second LIM domain of Isl2 | 8e-16 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 4e-15 | |
| cd09378 | 55 | cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain o | 7e-15 | |
| cd09475 | 59 | cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 | 1e-14 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 9e-14 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 1e-13 | |
| cd09474 | 59 | cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 | 2e-13 | |
| cd09390 | 55 | cd09390, LIM2_dLMO, The second LIM domain of dLMO | 4e-13 | |
| cd09389 | 55 | cd09389, LIM2_LMO1_LMO3, The second LIM domain of | 2e-11 | |
| COG5576 | 156 | COG5576, COG5576, Homeodomain-containing transcrip | 4e-10 | |
| COG5576 | 156 | COG5576, COG5576, Homeodomain-containing transcrip | 9e-10 | |
| cd09387 | 55 | cd09387, LIM2_LMO4, The second LIM domain of LMO4 | 5e-09 | |
| cd09385 | 56 | cd09385, LIM2_LMO2, The second LIM domain of LMO2 | 2e-07 | |
| cd09349 | 87 | cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | 1e-06 | |
| cd09358 | 53 | cd09358, LIM_Mical_like, The LIM domain of Mical ( | 2e-06 | |
| cd09451 | 53 | cd09451, LIM_RIL, The LIM domain of RIL | 9e-06 | |
| cd09352 | 54 | cd09352, LIM1_Ajuba_like, The first LIM domain of | 5e-05 | |
| cd09359 | 53 | cd09359, LIM_LASP_like, The LIM domain of LIM and | 7e-05 | |
| cd09442 | 53 | cd09442, LIM_Eplin_like, The Lim domain of Epithel | 7e-05 | |
| cd09485 | 53 | cd09485, LIM_Eplin_alpha_beta, The Lim domain of E | 1e-04 | |
| cd09338 | 53 | cd09338, LIM3_Paxillin_like, The third LIM domain | 1e-04 | |
| cd09429 | 53 | cd09429, LIM3_FHL1, The third LIM domain of Four a | 2e-04 | |
| cd09461 | 54 | cd09461, LIM3_Enigma_like_1, The third LIM domain | 6e-04 | |
| cd09327 | 52 | cd09327, LIM1_abLIM, The first LIM domain of actin | 7e-04 | |
| cd09479 | 56 | cd09479, LIM1_CRP1, The first LIM domain of Cystei | 7e-04 | |
| cd09459 | 55 | cd09459, LIM3_ENH, The third LIM domain of the Eni | 0.001 | |
| cd09350 | 54 | cd09350, LIM1_TRIP6, The first LIM domain of Thyro | 0.001 | |
| cd09414 | 58 | cd09414, LIM1_LIMPETin, The first LIM domain of pr | 0.001 | |
| cd09450 | 53 | cd09450, LIM_ALP, This family represents the LIM d | 0.001 | |
| cd09351 | 54 | cd09351, LIM1_LPP, The first LIM domain of lipoma | 0.001 | |
| cd09446 | 53 | cd09446, LIM_N_RAP, The LIM domain of N-RAP | 0.002 | |
| cd09365 | 54 | cd09365, LIM2_LIMK, The second LIM domain of LIMK | 0.002 | |
| cd09460 | 55 | cd09460, LIM3_ZASP_Cypher, The third LIM domain of | 0.002 | |
| cd09458 | 55 | cd09458, LIM3_Enigma, The third LIM domain of Enig | 0.002 | |
| cd09480 | 55 | cd09480, LIM1_CRP2, The first LIM domain of Cystei | 0.002 | |
| cd09392 | 53 | cd09392, LIM2_Lrg1p_like, The second LIM domain of | 0.002 | |
| cd09363 | 54 | cd09363, LIM3_Enigma_like, The third LIM domain of | 0.002 | |
| cd09421 | 59 | cd09421, LIM3_LIMPETin, The third LIM domain of pr | 0.003 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 0.003 | |
| cd09360 | 52 | cd09360, LIM_ALP_like, The LIM domain of ALP (acti | 0.003 | |
| cd09346 | 52 | cd09346, LIM3_FHL, The third LIM domain of Four an | 0.004 | |
| cd09431 | 57 | cd09431, LIM3_Fhl2, The third LIM domain of Four a | 0.004 | |
| cd09445 | 53 | cd09445, LIM_Mical_like_2, This domain belongs to | 0.004 |
| >gnl|CDD|188765 cd09379, LIM2_AWH, The second LIM domain of Arrowhead (AWH) | Back alignment and domain information |
|---|
Score = 127 bits (320), Expect = 2e-35
Identities = 46/55 (83%), Positives = 52/55 (94%)
Query: 619 CSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHY 673
C+KC R I++SDWVR+ARDHVYHLACFAC+ACKRQLSTGEEFAL EDRVLCK+HY
Sbjct: 1 CAKCSRNISASDWVRRARDHVYHLACFACDACKRQLSTGEEFALIEDRVLCKAHY 55
|
The second LIM domain of Arrowhead (AWH): Arrowhead belongs to the LHX protein family, which features two tandem N-terminal LIM domains and a C-terminal DNA binding homeodomain. Members of LHX family are found in the nucleus and act as transcription factors or cofactors. LHX proteins are critical for the development of specialized cells in multiple tissue types, including the nervous system, skeletal muscle, the heart, the kidneys, and endocrine organs such as the pituitary gland and the pancreas. During embryogenesis of Drosophila, Arrowhead is expressed in each abdominal segment and in the labial segment. Late in embryonic development, expression of arrowhead is refined to the abdominal histoblasts and salivary gland imaginal ring cells themselves. The Arrowhead gene required for establishment of a subset of imaginal tissues: the abdominal histoblasts and the salivary gland imaginal rings. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein. Length = 55 |
| >gnl|CDD|188769 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of Lhx7 and Lhx8 | Back alignment and domain information |
|---|
| >gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 | Back alignment and domain information |
|---|
| >gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9 family | Back alignment and domain information |
|---|
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
| >gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known as Lim1) and Lhx5 | Back alignment and domain information |
|---|
| >gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188856 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3b | Back alignment and domain information |
|---|
| >gnl|CDD|188857 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 | Back alignment and domain information |
|---|
| >gnl|CDD|188855 cd09471, LIM2_Isl2, The second LIM domain of Isl2 | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and Lmx1b | Back alignment and domain information |
|---|
| >gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188858 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 | Back alignment and domain information |
|---|
| >gnl|CDD|188776 cd09390, LIM2_dLMO, The second LIM domain of dLMO (Beaderx) | Back alignment and domain information |
|---|
| >gnl|CDD|188775 cd09389, LIM2_LMO1_LMO3, The second LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) | Back alignment and domain information |
|---|
| >gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) | Back alignment and domain information |
|---|
| >gnl|CDD|188771 cd09385, LIM2_LMO2, The second LIM domain of LMO2 (LIM domain only protein 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | Back alignment and domain information |
|---|
| >gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family | Back alignment and domain information |
|---|
| >gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL | Back alignment and domain information |
|---|
| >gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) | Back alignment and domain information |
|---|
| >gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM domains protein 1 (FHL1) | Back alignment and domain information |
|---|
| >gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma subfamily with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) | Back alignment and domain information |
|---|
| >gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) | Back alignment and domain information |
|---|
| >gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188834 cd09450, LIM_ALP, This family represents the LIM domain of ALP, actinin-associated LIM protein | Back alignment and domain information |
|---|
| >gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner (LPP) | Back alignment and domain information |
|---|
| >gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP | Back alignment and domain information |
|---|
| >gnl|CDD|188751 cd09365, LIM2_LIMK, The second LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
| >gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher family | Back alignment and domain information |
|---|
| >gnl|CDD|188842 cd09458, LIM3_Enigma, The third LIM domain of Enigma | Back alignment and domain information |
|---|
| >gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family | Back alignment and domain information |
|---|
| >gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
| >gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 768 | |||
| KOG4577|consensus | 383 | 100.0 | ||
| KOG1701|consensus | 468 | 99.75 | ||
| KOG0484|consensus | 125 | 99.67 | ||
| KOG2272|consensus | 332 | 99.67 | ||
| KOG0494|consensus | 332 | 99.66 | ||
| KOG1701|consensus | 468 | 99.62 | ||
| KOG0488|consensus | 309 | 99.58 | ||
| KOG0489|consensus | 261 | 99.56 | ||
| KOG0484|consensus | 125 | 99.55 | ||
| KOG2251|consensus | 228 | 99.55 | ||
| KOG0850|consensus | 245 | 99.51 | ||
| KOG0485|consensus | 268 | 99.51 | ||
| KOG0850|consensus | 245 | 99.5 | ||
| KOG0843|consensus | 197 | 99.49 | ||
| KOG0843|consensus | 197 | 99.48 | ||
| KOG0842|consensus | 307 | 99.48 | ||
| KOG0487|consensus | 308 | 99.47 | ||
| KOG0488|consensus | 309 | 99.47 | ||
| KOG0842|consensus | 307 | 99.46 | ||
| KOG0485|consensus | 268 | 99.45 | ||
| KOG0489|consensus | 261 | 99.45 | ||
| KOG0486|consensus | 351 | 99.44 | ||
| KOG0494|consensus | 332 | 99.44 | ||
| KOG0490|consensus | 235 | 99.43 | ||
| KOG1044|consensus | 670 | 99.43 | ||
| KOG0490|consensus | 235 | 99.43 | ||
| KOG0492|consensus | 246 | 99.42 | ||
| KOG0491|consensus | 194 | 99.4 | ||
| KOG1703|consensus | 479 | 99.4 | ||
| KOG0487|consensus | 308 | 99.39 | ||
| KOG2251|consensus | 228 | 99.39 | ||
| KOG0848|consensus | 317 | 99.39 | ||
| KOG0493|consensus | 342 | 99.36 | ||
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.35 | |
| KOG0844|consensus | 408 | 99.33 | ||
| KOG0848|consensus | 317 | 99.33 | ||
| KOG1703|consensus | 479 | 99.31 | ||
| KOG0492|consensus | 246 | 99.3 | ||
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.3 | |
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.26 | |
| KOG0844|consensus | 408 | 99.19 | ||
| KOG2272|consensus | 332 | 99.18 | ||
| KOG0493|consensus | 342 | 99.18 | ||
| KOG4577|consensus | 383 | 99.17 | ||
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.15 | |
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 99.15 | |
| KOG3802|consensus | 398 | 99.15 | ||
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.13 | |
| KOG0486|consensus | 351 | 99.13 | ||
| KOG0483|consensus | 198 | 99.12 | ||
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 99.1 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 99.1 | |
| KOG0847|consensus | 288 | 99.07 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.05 | |
| KOG0491|consensus | 194 | 99.04 | ||
| KOG0847|consensus | 288 | 99.03 | ||
| KOG0483|consensus | 198 | 99.02 | ||
| KOG3802|consensus | 398 | 99.02 | ||
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.02 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 98.98 | |
| KOG0849|consensus | 354 | 98.97 | ||
| KOG1044|consensus | 670 | 98.75 | ||
| KOG0775|consensus | 304 | 98.63 | ||
| KOG1168|consensus | 385 | 98.63 | ||
| KOG0849|consensus | 354 | 98.55 | ||
| KOG0775|consensus | 304 | 98.49 | ||
| KOG1168|consensus | 385 | 98.49 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.17 | |
| KOG1700|consensus | 200 | 97.89 | ||
| KOG0774|consensus | 334 | 97.74 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 97.51 | |
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 97.43 | |
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 97.42 | |
| KOG0774|consensus | 334 | 97.24 | ||
| KOG2252|consensus | 558 | 97.24 | ||
| KOG2252|consensus | 558 | 97.18 | ||
| KOG1146|consensus | 1406 | 96.19 | ||
| KOG1146|consensus | 1406 | 95.22 | ||
| KOG1702|consensus | 264 | 94.69 | ||
| KOG1700|consensus | 200 | 93.81 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 92.08 | |
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 91.46 | |
| KOG0773|consensus | 342 | 89.06 | ||
| KOG3623|consensus | 1007 | 88.69 | ||
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 87.02 | |
| KOG3623|consensus | 1007 | 85.19 | ||
| KOG0773|consensus | 342 | 84.46 | ||
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 83.58 |
| >KOG4577|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-36 Score=303.54 Aligned_cols=197 Identities=34% Similarity=0.503 Sum_probs=171.4
Q ss_pred cchhhhhhhhhhHHHHHhhcccccccccccceEEEeccccccccccccccccccccccCCCCcceeecccccccccchhh
Q psy17256 531 LEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLI 610 (768)
Q Consensus 531 ~~C~~c~k~Ia~~~~~~~~~~~s~~~~wh~~~~~c~~c~~~~~~~~g~r~~~~~~~~~dg~~~~~~~~~~~~c~~yC~~~ 610 (768)
|.|..|.+.|.++.+.|... ..||..|+.|+.|...+. ..||.+++..| |..|
T Consensus 34 p~CagC~q~IlDrFilKvl~-----R~wHs~CLkCs~C~~qL~------------------drCFsR~~s~y----Cked 86 (383)
T KOG4577|consen 34 PICAGCDQHILDRFILKVLD-----RHWHSSCLKCSDCHDQLA------------------DRCFSREGSVY----CKED 86 (383)
T ss_pred ccccchHHHHHHHHHHHHHh-----hhhhhhhcchhhhhhHHH------------------HHHhhcCCcee----ehHH
Confidence 45999999999999887743 299999999999985433 35788888885 4589
Q ss_pred hhhhcccccccCCCCCCCCcceeeecCceecccCccccccccccCCCCceEeec-CcccccccccccccCCcccCCCCCC
Q psy17256 611 CFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHE-DRVLCKSHYLELVDGGTTSSDDGAD 689 (768)
Q Consensus 611 y~~~f~~~C~~C~~~I~~~e~~~~a~~~~~H~~CF~C~~C~~~L~~G~~f~~~~-g~~~C~~~y~e~~~~~~~s~~~g~~ 689 (768)
|+++||++|.+|..+|.+...|.+|.+.+||..||.|..|+++|..|++|++.+ .++.|+.+|++.........
T Consensus 87 FfKrfGTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~k~~~~l----- 161 (383)
T KOG4577|consen 87 FFKRFGTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQKHCNEL----- 161 (383)
T ss_pred HHHHhCCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHhcccccc-----
Confidence 999999999999999999878888999999999999999999999999999775 78999999998765432211
Q ss_pred cccccCCCccccccccccHHHHHHHhhccccCCCCCHHHHHHHHHHhCCCCCccccccccchhHHHhhhhcccc
Q psy17256 690 SESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKM 763 (768)
Q Consensus 690 ~~~~~~~~k~rr~Rt~~s~~Ql~~Le~~F~~~~~p~~~~r~~LA~~lgls~~~V~vWFQNrRak~kk~~~~~~~ 763 (768)
.+....||+||.||+.|++.|+..|...+.|....|++|+..+||..++|||||||||||.||.++..+.
T Consensus 162 ----~gd~~nKRPRTTItAKqLETLK~AYn~SpKPARHVREQLsseTGLDMRVVQVWFQNRRAKEKRLKKDAGR 231 (383)
T KOG4577|consen 162 ----EGDASNKRPRTTITAKQLETLKQAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGR 231 (383)
T ss_pred ----ccccccCCCcceeeHHHHHHHHHHhcCCCchhHHHHHHhhhccCcceeehhhhhhhhhHHHHhhhhhcch
Confidence 1123468999999999999999999999999999999999999999999999999999999998877654
|
|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG0484|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG0494|consensus | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG0488|consensus | Back alignment and domain information |
|---|
| >KOG0489|consensus | Back alignment and domain information |
|---|
| >KOG0484|consensus | Back alignment and domain information |
|---|
| >KOG2251|consensus | Back alignment and domain information |
|---|
| >KOG0850|consensus | Back alignment and domain information |
|---|
| >KOG0485|consensus | Back alignment and domain information |
|---|
| >KOG0850|consensus | Back alignment and domain information |
|---|
| >KOG0843|consensus | Back alignment and domain information |
|---|
| >KOG0843|consensus | Back alignment and domain information |
|---|
| >KOG0842|consensus | Back alignment and domain information |
|---|
| >KOG0487|consensus | Back alignment and domain information |
|---|
| >KOG0488|consensus | Back alignment and domain information |
|---|
| >KOG0842|consensus | Back alignment and domain information |
|---|
| >KOG0485|consensus | Back alignment and domain information |
|---|
| >KOG0489|consensus | Back alignment and domain information |
|---|
| >KOG0486|consensus | Back alignment and domain information |
|---|
| >KOG0494|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG0492|consensus | Back alignment and domain information |
|---|
| >KOG0491|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG0487|consensus | Back alignment and domain information |
|---|
| >KOG2251|consensus | Back alignment and domain information |
|---|
| >KOG0848|consensus | Back alignment and domain information |
|---|
| >KOG0493|consensus | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG0844|consensus | Back alignment and domain information |
|---|
| >KOG0848|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG0492|consensus | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG0844|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG0493|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG3802|consensus | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >KOG0486|consensus | Back alignment and domain information |
|---|
| >KOG0483|consensus | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >KOG0847|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0491|consensus | Back alignment and domain information |
|---|
| >KOG0847|consensus | Back alignment and domain information |
|---|
| >KOG0483|consensus | Back alignment and domain information |
|---|
| >KOG3802|consensus | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >KOG0849|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG0775|consensus | Back alignment and domain information |
|---|
| >KOG1168|consensus | Back alignment and domain information |
|---|
| >KOG0849|consensus | Back alignment and domain information |
|---|
| >KOG0775|consensus | Back alignment and domain information |
|---|
| >KOG1168|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG0774|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >KOG0774|consensus | Back alignment and domain information |
|---|
| >KOG2252|consensus | Back alignment and domain information |
|---|
| >KOG2252|consensus | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >KOG0773|consensus | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >KOG0773|consensus | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 768 | ||||
| 2jtn_A | 182 | Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl | 5e-14 | ||
| 2rgt_A | 169 | Crystal Structure Of Lhx3 Lim Domains 1 And 2 With | 9e-14 | ||
| 3mmk_A | 169 | The Structural Basis For Partial Redundancy In A Cl | 1e-13 | ||
| 2dmq_A | 80 | Solution Structure Of The Homeobox Domain Of LimHOM | 6e-13 | ||
| 2da3_A | 80 | Solution Structure Of The Third Homeobox Domain Of | 5e-12 | ||
| 1bw5_A | 66 | The Nmr Solution Structure Of The Homeodomain Of Th | 5e-08 | ||
| 2m0c_A | 75 | Solution Nmr Structure Of Homeobox Domain Of Human | 8e-07 | ||
| 1fjl_A | 81 | Homeodomain From The Drosophila Paired Protein Boun | 1e-06 | ||
| 2l6y_B | 96 | Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = | 3e-06 | ||
| 2lxd_A | 125 | Backbone 1h, 13c, And 15n Chemical Shift Assignment | 4e-06 | ||
| 1rut_X | 188 | Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L | 4e-06 | ||
| 2dfy_X | 195 | Crystal Structure Of A Cyclized Protein Fusion Of L | 4e-06 | ||
| 2l7m_P | 68 | Solution Structure Of The Pitx2 Homeodomain R24h Mu | 6e-06 | ||
| 2l7f_P | 68 | Solution Structure Of The Pitx2 Homeodomain Length | 6e-06 | ||
| 3cmy_A | 61 | Structure Of A Homeodomain In Complex With Dna Leng | 1e-05 | ||
| 3a01_B | 67 | Crystal Structure Of Aristaless And Clawless Homeod | 1e-05 | ||
| 2xjy_A | 131 | Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 | 2e-05 | ||
| 2da2_A | 70 | Solution Structure Of The Second Homeobox Domain Of | 8e-05 | ||
| 2da2_A | 70 | Solution Structure Of The Second Homeobox Domain Of | 8e-05 | ||
| 3lnq_A | 58 | Structure Of Aristaless Homeodomain In Complex With | 8e-05 | ||
| 3lnq_A | 58 | Structure Of Aristaless Homeodomain In Complex With | 8e-05 | ||
| 2k40_A | 67 | Nmr Structure Of Hesx-1 Homeodomain Double Mutant R | 9e-05 | ||
| 2dmu_A | 70 | Solution Structure Of The Homeobox Domain Of Homeob | 1e-04 | ||
| 2da1_A | 70 | Solution Structure Of The First Homeobox Domain Of | 1e-04 | ||
| 2cue_A | 80 | Solution Structure Of The Homeobox Domain Of The Hu | 2e-04 | ||
| 2dms_A | 80 | Solution Structure Of The Homeobox Domain Of Homeob | 4e-04 |
| >pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 | Back alignment and structure |
|
| >pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 | Back alignment and structure |
| >pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 | Back alignment and structure |
| >pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 | Back alignment and structure |
| >pdb|2DA3|A Chain A, Solution Structure Of The Third Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 80 | Back alignment and structure |
| >pdb|1BW5|A Chain A, The Nmr Solution Structure Of The Homeodomain Of The Rat Insulin Gene Enhancer Protein Isl-1, 50 Structures Length = 66 | Back alignment and structure |
| >pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 | Back alignment and structure |
| >pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 | Back alignment and structure |
| >pdb|2L6Y|B Chain B, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 96 | Back alignment and structure |
| >pdb|2LXD|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For Lmo2(Lim2)- Ldb1(Lid) Length = 125 | Back alignment and structure |
| >pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 | Back alignment and structure |
| >pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 | Back alignment and structure |
| >pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 | Back alignment and structure |
| >pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 | Back alignment and structure |
| >pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 | Back alignment and structure |
| >pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 | Back alignment and structure |
| >pdb|2XJY|A Chain A, Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 Crystal Form Length = 131 | Back alignment and structure |
| >pdb|2DA2|A Chain A, Solution Structure Of The Second Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 70 | Back alignment and structure |
| >pdb|2DA2|A Chain A, Solution Structure Of The Second Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 70 | Back alignment and structure |
| >pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 | Back alignment and structure |
| >pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 | Back alignment and structure |
| >pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 | Back alignment and structure |
| >pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 | Back alignment and structure |
| >pdb|2DA1|A Chain A, Solution Structure Of The First Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 70 | Back alignment and structure |
| >pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 | Back alignment and structure |
| >pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 768 | |||
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 1e-29 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 4e-28 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 9e-28 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 2e-27 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 2e-27 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 2e-26 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 5e-08 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 4e-25 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 4e-25 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 5e-25 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 2e-08 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 7e-25 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 4e-08 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 8e-25 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 2e-07 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 3e-23 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 3e-23 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 5e-23 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 5e-23 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 6e-23 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 6e-23 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 3e-22 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 3e-22 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 3e-20 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 3e-20 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 6e-20 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 2e-19 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 3e-19 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 5e-19 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 5e-19 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 6e-18 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 7e-18 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 7e-18 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 2e-17 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 7e-17 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 6e-17 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 8e-10 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 7e-17 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 2e-16 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 1e-16 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 1e-16 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 2e-16 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 9e-16 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 5e-16 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 2e-15 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 8e-16 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 2e-15 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 3e-15 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 7e-15 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 3e-15 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 1e-12 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 5e-15 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 9e-15 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 1e-14 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 2e-14 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 3e-14 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 3e-14 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 3e-14 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 4e-14 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 1e-13 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 5e-14 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 5e-14 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 6e-14 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 1e-13 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 1e-13 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 1e-13 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 1e-13 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 2e-13 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 2e-13 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 5e-13 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 5e-13 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 5e-13 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 1e-12 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 1e-12 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 2e-12 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 2e-12 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 2e-12 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 3e-12 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 9e-12 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 9e-12 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 1e-11 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 2e-11 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 2e-11 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 2e-11 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 2e-11 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 2e-11 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 2e-11 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 6e-11 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 6e-11 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 7e-11 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 1e-10 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 2e-10 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 2e-10 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 2e-10 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 2e-10 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 2e-10 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 2e-10 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 9e-09 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 2e-10 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 4e-10 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 5e-10 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 8e-10 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 9e-10 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 2e-09 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 2e-08 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 2e-09 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 4e-09 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 3e-09 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 6e-09 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 1e-08 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 2e-08 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 5e-08 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 4e-08 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 8e-08 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 5e-08 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 3e-07 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 5e-08 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 6e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 2e-07 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 2e-07 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 2e-07 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 2e-07 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 3e-07 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 3e-07 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 3e-07 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 4e-07 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 6e-06 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 6e-07 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 6e-07 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 6e-07 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 6e-07 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 7e-07 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 7e-07 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 8e-07 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 8e-07 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 8e-07 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 8e-07 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 1e-06 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 7e-06 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 1e-06 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 1e-05 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 2e-06 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 5e-06 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 3e-06 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 3e-06 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 3e-06 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 3e-06 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 5e-06 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 5e-06 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 6e-06 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 6e-06 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 8e-06 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 8e-06 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 9e-06 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 9e-06 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 1e-05 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 5e-05 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 1e-05 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 1e-04 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 2e-05 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 2e-05 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 2e-05 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 2e-05 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 2e-05 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 2e-05 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 3e-05 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 3e-05 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 4e-05 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 4e-05 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 5e-05 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 5e-05 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 1e-04 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 1e-04 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 2e-04 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 2e-04 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 3e-04 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 3e-04 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 3e-04 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 3e-04 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 3e-04 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 3e-04 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 6e-04 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 6e-04 |
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 768 | |||
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.88 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.79 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.78 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.78 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.76 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.67 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.66 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.66 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.64 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.64 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.63 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.63 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.62 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.62 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.62 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.62 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.62 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.62 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.61 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.61 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.61 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.61 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.61 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 99.6 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.6 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.6 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.6 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.6 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.6 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.6 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.6 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.6 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 99.6 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 99.6 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.6 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.59 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.59 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.59 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 99.59 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.59 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.59 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.58 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.58 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.57 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 99.57 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 99.56 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.56 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 99.56 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.56 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 99.56 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.56 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.56 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.55 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.55 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.55 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 99.55 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.55 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.55 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 99.55 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.55 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.55 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 99.55 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.54 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.54 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.54 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.54 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.54 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 99.54 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.54 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.54 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.54 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.54 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 99.54 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.53 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.53 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 99.53 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.53 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.53 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.53 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.53 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.53 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 99.52 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.52 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 99.52 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.51 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.51 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.51 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 99.51 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.51 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.51 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.51 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 99.51 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 99.5 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 99.5 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 99.5 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 99.5 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 99.5 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 99.5 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.5 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.5 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 99.49 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 99.49 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.49 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.49 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 99.49 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.48 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.48 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.48 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.47 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 99.47 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.47 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 99.47 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 99.47 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 99.47 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 99.46 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.46 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 99.46 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 99.46 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 99.45 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.45 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 99.45 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 99.45 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 99.45 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.45 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 99.45 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 99.44 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.44 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.43 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 99.43 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 99.42 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 99.42 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 99.42 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 99.42 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 99.41 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 99.41 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.4 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 99.4 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 99.4 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.39 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 99.39 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 99.38 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 99.38 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 99.38 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 99.38 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 99.38 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 99.38 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 99.37 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.37 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.37 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.37 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.35 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 99.34 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 99.33 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 99.33 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 99.32 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.31 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.31 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.3 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 99.3 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 99.3 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.29 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.29 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.29 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.26 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 99.25 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.23 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 99.23 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 99.22 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.21 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.2 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.19 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.18 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.18 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.18 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 99.17 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.17 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.15 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.11 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 99.1 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.09 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.09 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.06 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 99.06 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.05 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.04 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.03 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.02 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.01 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.0 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 99.0 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 98.99 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 98.98 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 98.96 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 98.91 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 98.89 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 98.87 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 98.87 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 98.84 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 98.75 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 98.73 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 98.69 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 98.66 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 98.63 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 98.62 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 98.57 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 98.54 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 98.52 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 98.5 | |
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 98.49 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 98.47 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 98.43 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 98.4 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 98.4 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 98.39 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 98.39 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 98.38 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 98.36 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 98.36 | |
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 98.35 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 98.35 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 98.34 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 98.31 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 98.28 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 98.23 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 98.23 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 98.23 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 98.2 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 98.19 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 98.12 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 98.07 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 98.05 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 98.05 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 97.95 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 97.87 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 97.84 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 97.78 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 97.77 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 97.67 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 97.38 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 97.25 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 96.4 | |
| 2ys9_A | 70 | Homeobox and leucine zipper protein homez; homeodo | 80.99 |
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
Probab=99.88 E-value=1.2e-24 Score=213.98 Aligned_cols=157 Identities=27% Similarity=0.429 Sum_probs=125.8
Q ss_pred ccchhhhhhhhhhHH-HHHhhcccccccccccceEEEeccccccccccccccccccccccCCCCcceeecccccccccch
Q psy17256 530 HLEFHSFLKRIALVL-SEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSV 608 (768)
Q Consensus 530 g~~C~~c~k~Ia~~~-~~~~~~~~s~~~~wh~~~~~c~~c~~~~~~~~g~r~~~~~~~~~dg~~~~~~~~~~~~c~~yC~ 608 (768)
.+.|..|.+.|.+.. +.+.|+ .||+.||.|+.|+..+. +..|.+++.+ ||.
T Consensus 6 ~~~C~~C~~~I~~~~~~~a~~~------~wH~~CF~C~~C~~~L~------------------~~~f~~~g~~----yC~ 57 (169)
T 2rgt_A 6 IPMCAGCDQHILDRFILKALDR------HWHSKCLKCSDCHVPLA------------------ERCFSRGESV----YCK 57 (169)
T ss_dssp -CBBSSSSSBCCSSSCEECSSC------EECTTTSBCTTTCCBCC------------------SCCEESSSCE----ECH
T ss_pred CCccccCCCccCCcEEEEECCc------EEccccCccCCCCCcCC------------------CCCcccCCee----eec
Confidence 356999999999874 456677 99999999999995433 1226778888 456
Q ss_pred hhhhhhcccccccCCCCCCCCcceeeecCceecccCccccccccccCCCCceEe-ecCcccccccccccccCCcccCCCC
Q psy17256 609 LICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFAL-HEDRVLCKSHYLELVDGGTTSSDDG 687 (768)
Q Consensus 609 ~~y~~~f~~~C~~C~~~I~~~e~~~~a~~~~~H~~CF~C~~C~~~L~~G~~f~~-~~g~~~C~~~y~e~~~~~~~s~~~g 687 (768)
.||.++|+++|.+|+++|.+.+.++.|+++.||.+||+|..|+++|..|+.|+. .++++||+.||.++...+. +
T Consensus 58 ~~y~~~f~~~C~~C~~~I~~~~~v~~a~~~~~H~~CF~C~~C~~~L~~g~~f~~~~~g~~~C~~c~~~~~~~~~----~- 132 (169)
T 2rgt_A 58 DDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQGGS----G- 132 (169)
T ss_dssp HHHHHHHSCBCTTTCCBCCTTSEEEEETTEEEEGGGCBCTTTCCBCCTTCEEEECTTSCEEEHHHHHHHHHCC-------
T ss_pred ccccccccccccccccccCCCcEEEEcCCceEeeCCCcCCCCCCCCCCCCceEEccCCeEECHHHHHHHhhccC----C-
Confidence 999999999999999999988888999999999999999999999977888865 5789999999988776421 0
Q ss_pred CCcccccCCCccccccccccHHHHHHHhhccccCCCCCHH
Q psy17256 688 ADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQ 727 (768)
Q Consensus 688 ~~~~~~~~~~k~rr~Rt~~s~~Ql~~Le~~F~~~~~p~~~ 727 (768)
..+.+|+||.|+..|++.|+..|+.++||...
T Consensus 133 --------~~~~~rprt~~~~~q~~~l~~~f~~~~~~~~~ 164 (169)
T 2rgt_A 133 --------GSGGSGGGTPMVAASPERHDGGLQANPVEVQS 164 (169)
T ss_dssp ----------------EEEECCCCEECCSSCCCCCCCCCC
T ss_pred --------CCCCcCCCCcccHHHHHHHHHHHhCCCCcccc
Confidence 13467899999999999999999999998754
|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 768 | ||||
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 7e-17 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 7e-17 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 1e-15 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 1e-15 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 1e-15 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 1e-15 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 1e-15 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 1e-15 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 2e-15 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 5e-15 | |
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 2e-15 | |
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 2e-15 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 3e-15 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 3e-15 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 4e-15 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 6e-15 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 5e-15 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 5e-15 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 1e-14 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 1e-14 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 1e-14 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 1e-14 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 1e-14 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 1e-14 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 2e-14 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 2e-14 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 3e-14 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 3e-14 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 6e-14 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 6e-14 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 1e-13 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 1e-13 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 1e-13 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 1e-13 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 1e-13 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 1e-13 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 2e-13 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 2e-13 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 4e-13 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 4e-13 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 9e-13 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 9e-13 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 1e-12 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 1e-12 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 1e-12 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 1e-12 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 1e-12 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 1e-12 | |
| d1rutx3 | 31 | g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus | 3e-12 | |
| d1s7ea1 | 50 | a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M | 4e-12 | |
| d1s7ea1 | 50 | a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M | 4e-12 | |
| d1e3oc1 | 57 | a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( | 7e-12 | |
| d1e3oc1 | 57 | a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( | 7e-12 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 2e-11 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 2e-11 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 4e-11 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 4e-11 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 5e-10 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 5e-10 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 7e-10 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 7e-10 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 1e-08 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 1e-08 | |
| d2ecca1 | 76 | a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H | 7e-08 | |
| d2ecca1 | 76 | a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H | 1e-07 |
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Insulin gene enhancer protein isl-1 species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 73.3 bits (180), Expect = 7e-17
Identities = 26/60 (43%), Positives = 36/60 (60%)
Query: 59 KAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKH 118
K RVRT E+QL L+ + + PD E++ ++TGLS RV +VWFQN R + KK
Sbjct: 2 KTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKR 61
|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 31 | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 768 | |||
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.7 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.68 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.68 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.67 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.67 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.67 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.66 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.65 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.65 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.64 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.64 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.64 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.64 | |
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.63 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.63 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.62 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.62 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.62 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.61 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.61 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.61 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.61 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.59 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.59 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.59 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.59 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.59 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.58 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.58 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.57 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.56 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.56 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.55 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.55 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.54 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.53 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.52 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.52 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.52 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.51 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.51 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.49 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.48 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.47 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.45 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.45 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.45 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.44 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.43 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.39 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.38 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.37 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.34 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.31 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.29 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.28 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 99.28 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.24 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 99.23 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 99.2 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 99.18 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 99.15 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 99.1 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 99.03 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.67 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.59 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 98.42 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.31 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 98.06 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.98 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.97 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 97.78 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 97.72 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.59 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 97.56 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.45 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.44 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.42 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 97.3 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 97.13 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 96.94 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.91 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 96.9 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.88 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 96.8 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 96.73 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.62 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 96.59 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 96.47 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.45 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 96.36 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.24 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.2 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 96.18 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.18 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 96.12 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.96 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.94 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.87 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 95.83 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 95.45 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 95.4 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 95.4 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 95.37 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 95.22 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 95.21 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 95.01 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 94.74 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 94.72 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 94.49 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 93.62 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 93.42 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 93.22 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 92.76 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 92.74 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 92.52 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 92.26 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 92.18 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 92.17 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 91.79 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 91.65 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 91.25 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 90.94 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 90.58 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 90.39 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 90.38 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 90.25 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 90.18 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 89.93 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 89.88 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 89.67 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 89.32 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 88.92 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 88.9 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 88.67 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 88.22 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 88.22 | |
| d1v6ga2 | 40 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 86.7 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 84.79 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 83.8 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 82.9 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 82.5 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 81.99 |
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein hox-b13 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.70 E-value=1.9e-18 Score=136.06 Aligned_cols=58 Identities=28% Similarity=0.532 Sum_probs=55.6
Q ss_pred CCCCCccCCHHHHHHHHHhhhhCCCCCHHHHHHHHHHcCCCcccccccccccHHHHhh
Q psy17256 60 AKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKK 117 (768)
Q Consensus 60 ~rr~Rt~~t~~Ql~~Le~~F~~~~~p~~~~r~~la~~l~l~~~~vqvWFqNrRak~k~ 117 (768)
+||.||.||..|+.+||..|..++||+..+|++||..+||++.+|+|||||||+|+||
T Consensus 1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk 58 (58)
T d2craa1 1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK 58 (58)
T ss_dssp CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence 3677999999999999999999999999999999999999999999999999999986
|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|