Psyllid ID: psy17256


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------77
GADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGFGADSTDHTDSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKMKSSQNRPKYGYYPEPNKSFLVIKPQFLEEASLLFHDLHVQIVTEKRFLGGVIGNGDEKKNYVKEKVNQWIDCVKKLSEAAKKSPQAAFSVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVPSIFEHEISSSEHELFHLPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQEHNQCVKNAINTELVRKETEYQEKQERILSSLPPAKQRVLTRIVEGQSSHWLNVIPKSSDNFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDECIMMASYAWNGIVKEPIMRDSSSTSPALIADFKINGVWEAGGTAFFDNRIVNADAPSYSSQTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHYLELVDGGTTSSDDGADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKMKSSQN
cccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccEEEEcccHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHcccccccEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccEEcccccccEEEEcccHHHHHHHHHHHHHccccccccccccccccccHHHHHcccccccccccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHEEEEEEEEHHHHcccccccccccccccccccccccEEEEcccccccEEEEEEEcccccccccccccccccEEEcccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHcccccccccccc
cccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEcccccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHcccEEEEccccccccccccccccHHHHcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccHHcccccccccccccHHHHHHHHHHHHcccccccccccccccccccccEEEccccccEEEEcHHHHHHHHHHHHHHHHHHcccccEEEccccccccHHHHEEEccEEccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEEEcccccccccccEEEEcccEEEHHHHHHHcccHHcccccccHHHHHHHHHccEEEHHHHHHHHHHHccccccEEEEEcccEEEcccHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHHHHHHccc
gadsesshskskAKRVRTTFTEEQLQVLQANfqldsnpdgfgadstdhtdsesshskskAKRVRTTFTEEQLQVLQANfqldsnpdgqdlERIAQITGLSKRVTQVWFQNSRARQKkhlhtgkmkssqnrpkygyypepnksflvIKPQFLEEASLLFHDLHVQIVTEKrflggvigngdekkNYVKEKVNQWIDCVKKLSEAAKKSPQAAFSVVTKSLQCEWAFLQRVVNHcqdeyiplreiihstlvpsifeheisssehelfhlptrfgglgindpvetaQHAFAVTSEKCKVLVDSLLKQEQLNLQEHNQCVKNAINTELVRKETEYQEKQERILSSLPPAKQRVLTRIVEgqsshwlnvipkssdnfdlspvQFRDALALRYNhglkglptycdgcggemsvthalnckkgglvkhghdylRDECIMMASYAWngivkepimrdssstspalIADFKingvweaggtaffdnrivnadapsyssqtWNTIAKRHAQEKHLKYNTAAEdlrasftplvcstdgalhLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGtrqivkpygfddgaGLMYIRVRILLKGRLSVLICFRSfgakcskccrgiassDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHYLelvdggttssddgadsesshsksKAKRVRTTFTEEQLQVLQANfqldsnpdgqdlERIAQITGLSKRVTQVWFQNSRARQKkhlhtgkmkssqn
gadsesshskskakrvrtTFTEEQLQVLQANFQLDSNPDGFGADStdhtdsesshskskakrVRTTFTEEQLQVLQANfqldsnpdgQDLERIAQITGLSKRVTQVWFQNSrarqkkhlhtgkmkssqnrpkyGYYPEPNKSFLVIKPQFLEEASLLFHDLHVQIVTEKRflggvigngdekknyvKEKVNQWIDCVKKLSEAAKKSPQAAFSVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVPSIFEHEISSSEHELFHLPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQEHNQCVKNAINTELVRKETEYQEKQerilsslppakqRVLTRIVegqsshwlnviPKSSDNFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDECIMMASYAWNGIVKEPIMRDSSSTSPALIADFKINGVWEAGGTAFFDNRIVNADAPSYSSQTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKavslrlrgtrqivkpygfddgaglMYIRVRILLKGRLSVLICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHYLELVDGgttssddgadsesshskskakrVRTTFTEEQLQVLQANfqldsnpdgQDLERIAQITGLSKRVTQVWFQnsrarqkkhlhtgkmkssqn
GADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGFGadstdhtdsesshskskakRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKMKSSQNRPKYGYYPEPNKSFLVIKPQFLEEASLLFHDLHVQIVTEKRFLGGVIGNGDEKKNYVKEKVNQWIDCVKKLSEAAKKSPQAAFSVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVPsifeheisssehelfhlPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQEHNQCVKNAINTELVRKETEYQEKQERILSSLPPAKQRVLTRIVEGQSSHWLNVIPKSSDNFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDECIMMASYAWNGIVKEPIMRDSSSTSPALIADFKINGVWEAGGTAFFDNRIVNADAPSYSSQTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHYLELVdggttssddgadsesshsKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKMKSSQN
*******************************************************************************************RIAQITGLSKRVTQVWFQ************************GYYPEPNKSFLVIKPQFLEEASLLFHDLHVQIVTEKRFLGGVIGNGDEKKNYVKEKVNQWIDCVKKLSEAA****QAAFSVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVPSIFEHEISSSEHELFHLPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQEHNQCVKNAINTELV**********************RVLTRIVEGQSSHWLNVIPKSSDNFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDECIMMASYAWNGIVKEPIMR******PALIADFKINGVWEAGGTAFFDNRIVNADAPSYSSQTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHYLELVD****************************************************RIAQITGLSKRVTQVWFQ********************
*******************************************************************TEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRAR**************************************************************************************************SVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVPSIFEHEISSSEHELFHLPTRFGGLGINDPV***************VLVDSLLKQEQLNLQEHNQCVKNAINTELVRKETEYQEKQERILSSLPPAK*RVLTRIVEGQSSHWLNVIPKSSDNFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDECIMMASYAWNGIVKEPIMRD********IADFKINGVWEAGGTAFFDNRIVNADAPSYSSQTWNTI**********KYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGE*FALHEDRVLCKSHYLELVDGGTTSSD***************************************D**DLERIAQITGLSKRVTQVWFQNS******************
******************TFTEEQLQVLQANFQLDSNPDGFGA**********************TFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNS******************RPKYGYYPEPNKSFLVIKPQFLEEASLLFHDLHVQIVTEKRFLGGVIGNGDEKKNYVKEKVNQWIDCVKKLS************VVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVPSIFEHEISSSEHELFHLPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQEHNQCVKNAINTELVRKETEYQEKQERILSSLPPAKQRVLTRIVEGQSSHWLNVIPKSSDNFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDECIMMASYAWNGIVKEPIMRDSSSTSPALIADFKINGVWEAGGTAFFDNRIVNADAPSYSSQTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHYLELVDGGT***********************TFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNS******************
*************************************************************RVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKK*******************************QFLEEASLLFHDLHVQIVTEKRFLGGVIGNGDEKKNYVKEKVNQWIDCVKKLSEAAKKSPQAAFSVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVPSIFEHEISSSEHELFHLPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQEHNQCVKNAINTELVRKETEYQEKQERILSSLPPAKQRVLTRIVEGQSSHWLNVIPKSSDNFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDECIMMASYAWNGIVKEPIMRDSSSTSPALIADFKINGVWEAGGTAFFDNRIVNADAPSYSSQTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHYLELVDG*********************RVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKK************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGFGADSTDHTDSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKMKSSQNRPKYGYYPEPNKSFLVIKPQFLEEASLLFHDLHVQIVTEKRFLGGVIGNGDEKKNYVKEKVNQWIDCVKKLSEAAKKSPQAAFSVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVPSIFEHEISSSEHELFHLPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQEHNQCVxxxxxxxxxxxxxxxxxxxxxILSSLPPAKQRVLTRIVEGQSSHWLNVIPKSSDNFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDECIMMASYAWNGIVKEPIMRDSSSTSPALIADFKINGVWEAGGTAFFDNRIVNADAPSYSSQTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHYLELVDGGTTSSDDGADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKMKSSQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query768 2.2.26 [Sep-21-2011]
Q8IRC7275 LIM/homeobox protein Awh yes N/A 0.196 0.549 0.796 5e-68
Q9UPM6363 LIM/homeobox protein Lhx6 no N/A 0.190 0.402 0.545 8e-44
Q9R1R0363 LIM/homeobox protein Lhx6 no N/A 0.190 0.402 0.545 9e-44
Q68G74356 LIM/homeobox protein Lhx8 no N/A 0.190 0.410 0.560 4e-43
O35652367 LIM/homeobox protein Lhx8 no N/A 0.190 0.397 0.554 2e-42
Q9UBR4 397 LIM/homeobox protein Lhx3 no N/A 0.170 0.329 0.424 4e-26
P50481 400 LIM/homeobox protein Lhx3 no N/A 0.170 0.327 0.424 4e-26
O97581 383 LIM/homeobox protein Lhx3 no N/A 0.170 0.342 0.424 5e-26
P53412 395 LIM/homeobox protein Lhx3 no N/A 0.170 0.331 0.431 6e-26
P50212340 Insulin gene enhancer pro N/A N/A 0.187 0.423 0.387 6e-26
>sp|Q8IRC7|AWH_DROME LIM/homeobox protein Awh OS=Drosophila melanogaster GN=Awh PE=1 SV=1 Back     alignment and function desciption
 Score =  259 bits (663), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 121/152 (79%), Positives = 138/152 (90%), Gaps = 1/152 (0%)

Query: 613 RSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSH 672
           ++FGAKCSKCCRGI++SDWVR+AR+ V+HLACFAC+ C RQLSTGE+FAL +DRVLCK+H
Sbjct: 63  KNFGAKCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAH 122

Query: 673 YLELVDGGTTSSDDGADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERI 732
           YLE V+GGTTSSD+G D +  H KSK KRVRTTFTEEQLQVLQANFQ+DSNPDGQDLERI
Sbjct: 123 YLETVEGGTTSSDEGCDGDGYH-KSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERI 181

Query: 733 AQITGLSKRVTQVWFQNSRARQKKHLHTGKMK 764
           A +TGLSKRVTQVWFQNSRARQKKH+H GK K
Sbjct: 182 ASVTGLSKRVTQVWFQNSRARQKKHIHAGKNK 213




Probable transcription factor. Required for the establishment of a subset of imaginal tissues: the abdominal histoblasts and the salivary gland imaginal rings.
Drosophila melanogaster (taxid: 7227)
>sp|Q9UPM6|LHX6_HUMAN LIM/homeobox protein Lhx6 OS=Homo sapiens GN=LHX6 PE=2 SV=2 Back     alignment and function description
>sp|Q9R1R0|LHX6_MOUSE LIM/homeobox protein Lhx6 OS=Mus musculus GN=Lhx6 PE=1 SV=2 Back     alignment and function description
>sp|Q68G74|LHX8_HUMAN LIM/homeobox protein Lhx8 OS=Homo sapiens GN=LHX8 PE=2 SV=2 Back     alignment and function description
>sp|O35652|LHX8_MOUSE LIM/homeobox protein Lhx8 OS=Mus musculus GN=Lhx8 PE=2 SV=4 Back     alignment and function description
>sp|Q9UBR4|LHX3_HUMAN LIM/homeobox protein Lhx3 OS=Homo sapiens GN=LHX3 PE=1 SV=2 Back     alignment and function description
>sp|P50481|LHX3_MOUSE LIM/homeobox protein Lhx3 OS=Mus musculus GN=Lhx3 PE=1 SV=1 Back     alignment and function description
>sp|O97581|LHX3_PIG LIM/homeobox protein Lhx3 (Fragment) OS=Sus scrofa GN=LHX3 PE=2 SV=1 Back     alignment and function description
>sp|P53412|LHX3_CHICK LIM/homeobox protein Lhx3 OS=Gallus gallus GN=LHX3 PE=2 SV=1 Back     alignment and function description
>sp|P50212|ISL2B_ONCTS Insulin gene enhancer protein ISL-2B (Fragment) OS=Oncorhynchus tschawytscha GN=isl2b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query768
340384014 1577 PREDICTED: hypothetical protein LOC10063 0.601 0.292 0.390 5e-94
340383257 938 PREDICTED: hypothetical protein LOC10063 0.533 0.437 0.389 1e-78
91078266343 PREDICTED: similar to GA10520-PA [Tribol 0.197 0.443 0.882 1e-73
270004863349 arrowhead [Tribolium castaneum] 0.197 0.435 0.882 2e-73
379698940274 arrowhead PA [Bombyx mori] gi|346223348| 0.200 0.562 0.864 5e-72
357605400406 hypothetical protein KGM_21596 [Danaus p 0.200 0.379 0.841 2e-70
195125467239 GI12512 [Drosophila mojavensis] gi|19391 0.196 0.631 0.809 1e-67
195375542239 GJ12418 [Drosophila virilis] gi|19415371 0.196 0.631 0.809 1e-67
195441498275 GK20529 [Drosophila willistoni] gi|19416 0.213 0.596 0.754 1e-67
195016322239 GH16430 [Drosophila grimshawi] gi|193897 0.196 0.631 0.809 2e-67
>gi|340384014|ref|XP_003390510.1| PREDICTED: hypothetical protein LOC100638826 [Amphimedon queenslandica] Back     alignment and taxonomy information
 Score =  352 bits (903), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 181/464 (39%), Positives = 269/464 (57%), Gaps = 2/464 (0%)

Query: 131  PKYGYYPEPNKSFLVIKPQFLEEASLLFHDLHVQIVTEKRFLGGVIGNGDEKKNYVKEKV 190
            P +GY+PEP+K  L++    L+ A LLF D  V IV + +FLGGVIGN   + +++  K 
Sbjct: 1108 PLFGYFPEPSKCHLIVSESNLDNARLLFRDTGVNIVKDGKFLGGVIGNKVARDSFISSKS 1167

Query: 191  NQWIDCVKKLSEAAKKSPQAAFSVVTKSLQCEWAFLQRVVNHCQDEYIPLREIIHSTLVP 250
             +W   +++LS      PQ+A+ V++K+LQ EW +LQR+++ C   +  +   I  + +P
Sbjct: 1168 EKWSGYIRQLSSLCVSEPQSAYIVLSKALQYEWIYLQRIMSDCGGLFNDVTHDIAHSFLP 1227

Query: 251  SIFEHEISSSEHELFHLPTRFGGLGINDPVETAQHAFAVTSEKCKVLVDSLLKQEQLNLQ 310
            S+F   +S SE   F LP R GGL I DP  T+  ++A + +    LV+++        +
Sbjct: 1228 SLFGCGVSESERLFFSLPIRMGGLNIKDPTVTSSFSYAASRDATSYLVNAIKNNLDFESE 1287

Query: 311  EHNQCVKNAINTELVRKETEYQEKQERILSSLPPAKQRVLTRIVEGQSSHWLNVIPKSSD 370
             HN CV  +  +      ++ ++  E I++   P  +R L +  +  S+ WL+V P + D
Sbjct: 1288 AHNDCVHASRLSAYNASTSQSEQLYENIMTDASPMLKRTLQKARDCLSA-WLSVPPIAKD 1346

Query: 371  NFDLSPVQFRDALALRYNHGLKGLPTYCDGCGGEMSVTHALNCKKGGLVKHGHDYLRDEC 430
            NFDLS  +FRD LALRY   L  LP  CDGCG E SVTHAL+C+KGGLV   H+ +RD  
Sbjct: 1347 NFDLSANEFRDGLALRYGKPLLQLPPTCDGCGSEFSVTHALDCRKGGLVVQRHNEIRDMI 1406

Query: 431  IMMASYAWNGIVKEPIMRDSS-STSPALIADFKINGVWEAGGTAFFDNRIVNADAPSYSS 489
              +AS  W  +VKEP++ DSS S +  L+AD  I GVW+   TA FD R+V+ DA SY  
Sbjct: 1407 CSLASIVWGQVVKEPVVSDSSASDTGGLVADIAIRGVWQRQATALFDVRVVDTDAKSYLR 1466

Query: 490  QTWNTIAKRHAQEKHLKYNTAAEDLRASFTPLVCSTDGALHLEFHSFLKRIALVLSEKWK 549
            Q+  ++     +EK  KY+ A      SFTPL  S DG +  E  +FL R+   L+ KW+
Sbjct: 1467 QSPQSVLATAEREKKRKYSAACTARHVSFTPLCFSVDGLMGSETKTFLDRLGDHLASKWE 1526

Query: 550  KMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGL 593
            + Y  V+ WLRV+   ++L+A  L LRGTR  ++P   +D A +
Sbjct: 1527 RPYSVVVHWLRVKMSMALLRATDLCLRGTRSKLRPMLIEDDAPI 1570




Source: Amphimedon queenslandica

Species: Amphimedon queenslandica

Genus: Amphimedon

Family: Niphatidae

Order: Haplosclerida

Class: Demospongiae

Phylum: Porifera

Superkingdom: Eukaryota

>gi|340383257|ref|XP_003390134.1| PREDICTED: hypothetical protein LOC100637810, partial [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|91078266|ref|XP_971202.1| PREDICTED: similar to GA10520-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270004863|gb|EFA01311.1| arrowhead [Tribolium castaneum] Back     alignment and taxonomy information
>gi|379698940|ref|NP_001243941.1| arrowhead PA [Bombyx mori] gi|346223348|dbj|BAK78925.1| arrowhead PA [Bombyx mori] Back     alignment and taxonomy information
>gi|357605400|gb|EHJ64588.1| hypothetical protein KGM_21596 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195125467|ref|XP_002007199.1| GI12512 [Drosophila mojavensis] gi|193918808|gb|EDW17675.1| GI12512 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195375542|ref|XP_002046559.1| GJ12418 [Drosophila virilis] gi|194153717|gb|EDW68901.1| GJ12418 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195441498|ref|XP_002068546.1| GK20529 [Drosophila willistoni] gi|194164631|gb|EDW79532.1| GK20529 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195016322|ref|XP_001984389.1| GH16430 [Drosophila grimshawi] gi|193897871|gb|EDV96737.1| GH16430 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query768
FB|FBgn0013751275 Awh "Arrowhead" [Drosophila me 0.196 0.549 0.730 2.8e-57
WB|WBGene00002987355 lim-4 [Caenorhabditis elegans 0.175 0.380 0.625 4.6e-43
ZFIN|ZDB-GENE-041025-1375 lhx6 "LIM homeobox 6" [Danio r 0.195 0.4 0.531 2.7e-38
UNIPROTKB|E2REU0379 LHX8 "Uncharacterized protein" 0.201 0.408 0.512 5.9e-38
UNIPROTKB|J9PBA6295 LHX8 "Uncharacterized protein" 0.201 0.525 0.512 5.9e-38
UNIPROTKB|E9PGE3346 LHX8 "LIM/homeobox protein Lhx 0.201 0.447 0.512 5.9e-38
UNIPROTKB|Q68G74356 LHX8 "LIM/homeobox protein Lhx 0.201 0.435 0.512 5.9e-38
UNIPROTKB|C8YLT4295 Lhx8 "LIM homeobox 8" [Sus scr 0.201 0.525 0.512 5.9e-38
UNIPROTKB|F1P4G9347 LHX8 "Uncharacterized protein" 0.191 0.423 0.532 7.5e-38
UNIPROTKB|F1NLU0354 F1NLU0 "Uncharacterized protei 0.194 0.420 0.528 9.7e-38
FB|FBgn0013751 Awh "Arrowhead" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 589 (212.4 bits), Expect = 2.8e-57, P = 2.8e-57
 Identities = 111/152 (73%), Positives = 125/152 (82%)

Query:   613 RSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSH 672
             ++FGAKCSKCCRGI++SDWVR+AR+ V+HLACFAC+ C RQLSTGE+FAL +DRVLCK+H
Sbjct:    63 KNFGAKCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAH 122

Query:   673 YLELVXXXXXXXXXXXXXXXXXXKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERI 732
             YLE V                  KSK KRVRTTFTEEQLQVLQANFQ+DSNPDGQDLERI
Sbjct:   123 YLETVEGGTTSSDEGCDGDGYH-KSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERI 181

Query:   733 AQITGLSKRVTQVWFQNSRARQKKHLHTGKMK 764
             A +TGLSKRVTQVWFQNSRARQKKH+H GK K
Sbjct:   182 ASVTGLSKRVTQVWFQNSRARQKKHIHAGKNK 213


GO:0007444 "imaginal disc development" evidence=IMP
GO:0005634 "nucleus" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
WB|WBGene00002987 lim-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041025-1 lhx6 "LIM homeobox 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2REU0 LHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9PBA6 LHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PGE3 LHX8 "LIM/homeobox protein Lhx8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q68G74 LHX8 "LIM/homeobox protein Lhx8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C8YLT4 Lhx8 "LIM homeobox 8" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4G9 LHX8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLU0 F1NLU0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8IRC7AWH_DROMENo assigned EC number0.79600.19660.5490yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query768
cd0937955 cd09379, LIM2_AWH, The second LIM domain of Arrowh 2e-35
cd0938355 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of 7e-23
cd0938255 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 4e-22
cd0937759 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of 5e-20
pfam0004657 pfam00046, Homeobox, Homeobox domain 9e-20
pfam0004657 pfam00046, Homeobox, Homeobox domain 9e-20
cd0937656 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of 1e-19
smart0038957 smart00389, HOX, Homeodomain 9e-18
smart0038957 smart00389, HOX, Homeodomain 9e-18
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-17
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-17
cd0937556 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of 5e-17
cd0937455 cd09374, LIM2_Isl, The second LIM domain of Isl, a 1e-16
cd0947257 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3 2e-16
cd0947356 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 7e-16
cd0947155 cd09471, LIM2_Isl2, The second LIM domain of Isl2 8e-16
pfam0041258 pfam00412, LIM, LIM domain 4e-15
cd0937855 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain o 7e-15
cd0947559 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 1e-14
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 9e-14
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 1e-13
cd0947459 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 2e-13
cd0939055 cd09390, LIM2_dLMO, The second LIM domain of dLMO 4e-13
cd0938955 cd09389, LIM2_LMO1_LMO3, The second LIM domain of 2e-11
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 4e-10
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 9e-10
cd0938755 cd09387, LIM2_LMO4, The second LIM domain of LMO4 5e-09
cd0938556 cd09385, LIM2_LMO2, The second LIM domain of LMO2 2e-07
cd0934987 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin 1e-06
cd0935853 cd09358, LIM_Mical_like, The LIM domain of Mical ( 2e-06
cd0945153 cd09451, LIM_RIL, The LIM domain of RIL 9e-06
cd0935254 cd09352, LIM1_Ajuba_like, The first LIM domain of 5e-05
cd0935953 cd09359, LIM_LASP_like, The LIM domain of LIM and 7e-05
cd0944253 cd09442, LIM_Eplin_like, The Lim domain of Epithel 7e-05
cd0948553 cd09485, LIM_Eplin_alpha_beta, The Lim domain of E 1e-04
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 1e-04
cd0942953 cd09429, LIM3_FHL1, The third LIM domain of Four a 2e-04
cd0946154 cd09461, LIM3_Enigma_like_1, The third LIM domain 6e-04
cd0932752 cd09327, LIM1_abLIM, The first LIM domain of actin 7e-04
cd0947956 cd09479, LIM1_CRP1, The first LIM domain of Cystei 7e-04
cd0945955 cd09459, LIM3_ENH, The third LIM domain of the Eni 0.001
cd0935054 cd09350, LIM1_TRIP6, The first LIM domain of Thyro 0.001
cd0941458 cd09414, LIM1_LIMPETin, The first LIM domain of pr 0.001
cd0945053 cd09450, LIM_ALP, This family represents the LIM d 0.001
cd0935154 cd09351, LIM1_LPP, The first LIM domain of lipoma 0.001
cd0944653 cd09446, LIM_N_RAP, The LIM domain of N-RAP 0.002
cd0936554 cd09365, LIM2_LIMK, The second LIM domain of LIMK 0.002
cd0946055 cd09460, LIM3_ZASP_Cypher, The third LIM domain of 0.002
cd0945855 cd09458, LIM3_Enigma, The third LIM domain of Enig 0.002
cd0948055 cd09480, LIM1_CRP2, The first LIM domain of Cystei 0.002
cd0939253 cd09392, LIM2_Lrg1p_like, The second LIM domain of 0.002
cd0936354 cd09363, LIM3_Enigma_like, The third LIM domain of 0.002
cd0942159 cd09421, LIM3_LIMPETin, The third LIM domain of pr 0.003
cd0940153 cd09401, LIM_TLP_like, The LIM domains of thymus L 0.003
cd0936052 cd09360, LIM_ALP_like, The LIM domain of ALP (acti 0.003
cd0934652 cd09346, LIM3_FHL, The third LIM domain of Four an 0.004
cd0943157 cd09431, LIM3_Fhl2, The third LIM domain of Four a 0.004
cd0944553 cd09445, LIM_Mical_like_2, This domain belongs to 0.004
>gnl|CDD|188765 cd09379, LIM2_AWH, The second LIM domain of Arrowhead (AWH) Back     alignment and domain information
 Score =  127 bits (320), Expect = 2e-35
 Identities = 46/55 (83%), Positives = 52/55 (94%)

Query: 619 CSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHEDRVLCKSHY 673
           C+KC R I++SDWVR+ARDHVYHLACFAC+ACKRQLSTGEEFAL EDRVLCK+HY
Sbjct: 1   CAKCSRNISASDWVRRARDHVYHLACFACDACKRQLSTGEEFALIEDRVLCKAHY 55


The second LIM domain of Arrowhead (AWH): Arrowhead belongs to the LHX protein family, which features two tandem N-terminal LIM domains and a C-terminal DNA binding homeodomain. Members of LHX family are found in the nucleus and act as transcription factors or cofactors. LHX proteins are critical for the development of specialized cells in multiple tissue types, including the nervous system, skeletal muscle, the heart, the kidneys, and endocrine organs such as the pituitary gland and the pancreas. During embryogenesis of Drosophila, Arrowhead is expressed in each abdominal segment and in the labial segment. Late in embryonic development, expression of arrowhead is refined to the abdominal histoblasts and salivary gland imaginal ring cells themselves. The Arrowhead gene required for establishment of a subset of imaginal tissues: the abdominal histoblasts and the salivary gland imaginal rings. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein. Length = 55

>gnl|CDD|188769 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of Lhx7 and Lhx8 Back     alignment and domain information
>gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 Back     alignment and domain information
>gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX protein family Back     alignment and domain information
>gnl|CDD|188856 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3b Back     alignment and domain information
>gnl|CDD|188857 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 Back     alignment and domain information
>gnl|CDD|188855 cd09471, LIM2_Isl2, The second LIM domain of Isl2 Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and Lmx1b Back     alignment and domain information
>gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188858 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 Back     alignment and domain information
>gnl|CDD|188776 cd09390, LIM2_dLMO, The second LIM domain of dLMO (Beaderx) Back     alignment and domain information
>gnl|CDD|188775 cd09389, LIM2_LMO1_LMO3, The second LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188771 cd09385, LIM2_LMO2, The second LIM domain of LMO2 (LIM domain only protein 2) Back     alignment and domain information
>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family Back     alignment and domain information
>gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL Back     alignment and domain information
>gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like proteins Back     alignment and domain information
>gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins Back     alignment and domain information
>gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) like proteins Back     alignment and domain information
>gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma subfamily with unknown function Back     alignment and domain information
>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) Back     alignment and domain information
>gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188834 cd09450, LIM_ALP, This family represents the LIM domain of ALP, actinin-associated LIM protein Back     alignment and domain information
>gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP Back     alignment and domain information
>gnl|CDD|188751 cd09365, LIM2_LIMK, The second LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188842 cd09458, LIM3_Enigma, The third LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family Back     alignment and domain information
>gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 768
KOG4577|consensus 383 100.0
KOG1701|consensus468 99.75
KOG0484|consensus125 99.67
KOG2272|consensus332 99.67
KOG0494|consensus332 99.66
KOG1701|consensus468 99.62
KOG0488|consensus309 99.58
KOG0489|consensus261 99.56
KOG0484|consensus125 99.55
KOG2251|consensus228 99.55
KOG0850|consensus245 99.51
KOG0485|consensus268 99.51
KOG0850|consensus245 99.5
KOG0843|consensus197 99.49
KOG0843|consensus197 99.48
KOG0842|consensus307 99.48
KOG0487|consensus308 99.47
KOG0488|consensus309 99.47
KOG0842|consensus307 99.46
KOG0485|consensus268 99.45
KOG0489|consensus261 99.45
KOG0486|consensus351 99.44
KOG0494|consensus 332 99.44
KOG0490|consensus235 99.43
KOG1044|consensus 670 99.43
KOG0490|consensus 235 99.43
KOG0492|consensus246 99.42
KOG0491|consensus194 99.4
KOG1703|consensus479 99.4
KOG0487|consensus308 99.39
KOG2251|consensus 228 99.39
KOG0848|consensus317 99.39
KOG0493|consensus342 99.36
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.35
KOG0844|consensus408 99.33
KOG0848|consensus317 99.33
KOG1703|consensus479 99.31
KOG0492|consensus246 99.3
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.3
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.26
KOG0844|consensus 408 99.19
KOG2272|consensus332 99.18
KOG0493|consensus342 99.18
KOG4577|consensus383 99.17
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.15
COG5576156 Homeodomain-containing transcription factor [Trans 99.15
KOG3802|consensus398 99.15
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.13
KOG0486|consensus 351 99.13
KOG0483|consensus198 99.12
COG5576156 Homeodomain-containing transcription factor [Trans 99.1
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.1
KOG0847|consensus288 99.07
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.05
KOG0491|consensus194 99.04
KOG0847|consensus288 99.03
KOG0483|consensus198 99.02
KOG3802|consensus398 99.02
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.02
cd0008659 homeodomain Homeodomain; DNA binding domains invol 98.98
KOG0849|consensus354 98.97
KOG1044|consensus 670 98.75
KOG0775|consensus304 98.63
KOG1168|consensus385 98.63
KOG0849|consensus 354 98.55
KOG0775|consensus304 98.49
KOG1168|consensus385 98.49
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.17
KOG1700|consensus200 97.89
KOG0774|consensus334 97.74
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 97.51
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.43
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.42
KOG0774|consensus334 97.24
KOG2252|consensus558 97.24
KOG2252|consensus558 97.18
KOG1146|consensus1406 96.19
KOG1146|consensus 1406 95.22
KOG1702|consensus 264 94.69
KOG1700|consensus200 93.81
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 92.08
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 91.46
KOG0773|consensus342 89.06
KOG3623|consensus1007 88.69
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 87.02
KOG3623|consensus 1007 85.19
KOG0773|consensus342 84.46
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 83.58
>KOG4577|consensus Back     alignment and domain information
Probab=100.00  E-value=1.8e-36  Score=303.54  Aligned_cols=197  Identities=34%  Similarity=0.503  Sum_probs=171.4

Q ss_pred             cchhhhhhhhhhHHHHHhhcccccccccccceEEEeccccccccccccccccccccccCCCCcceeecccccccccchhh
Q psy17256        531 LEFHSFLKRIALVLSEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSVLI  610 (768)
Q Consensus       531 ~~C~~c~k~Ia~~~~~~~~~~~s~~~~wh~~~~~c~~c~~~~~~~~g~r~~~~~~~~~dg~~~~~~~~~~~~c~~yC~~~  610 (768)
                      |.|..|.+.|.++.+.|...     ..||..|+.|+.|...+.                  ..||.+++..|    |..|
T Consensus        34 p~CagC~q~IlDrFilKvl~-----R~wHs~CLkCs~C~~qL~------------------drCFsR~~s~y----Cked   86 (383)
T KOG4577|consen   34 PICAGCDQHILDRFILKVLD-----RHWHSSCLKCSDCHDQLA------------------DRCFSREGSVY----CKED   86 (383)
T ss_pred             ccccchHHHHHHHHHHHHHh-----hhhhhhhcchhhhhhHHH------------------HHHhhcCCcee----ehHH
Confidence            45999999999999887743     299999999999985433                  35788888885    4589


Q ss_pred             hhhhcccccccCCCCCCCCcceeeecCceecccCccccccccccCCCCceEeec-CcccccccccccccCCcccCCCCCC
Q psy17256        611 CFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHE-DRVLCKSHYLELVDGGTTSSDDGAD  689 (768)
Q Consensus       611 y~~~f~~~C~~C~~~I~~~e~~~~a~~~~~H~~CF~C~~C~~~L~~G~~f~~~~-g~~~C~~~y~e~~~~~~~s~~~g~~  689 (768)
                      |+++||++|.+|..+|.+...|.+|.+.+||..||.|..|+++|..|++|++.+ .++.|+.+|++.........     
T Consensus        87 FfKrfGTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~k~~~~l-----  161 (383)
T KOG4577|consen   87 FFKRFGTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQKHCNEL-----  161 (383)
T ss_pred             HHHHhCCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHhcccccc-----
Confidence            999999999999999999878888999999999999999999999999999775 78999999998765432211     


Q ss_pred             cccccCCCccccccccccHHHHHHHhhccccCCCCCHHHHHHHHHHhCCCCCccccccccchhHHHhhhhcccc
Q psy17256        690 SESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKHLHTGKM  763 (768)
Q Consensus       690 ~~~~~~~~k~rr~Rt~~s~~Ql~~Le~~F~~~~~p~~~~r~~LA~~lgls~~~V~vWFQNrRak~kk~~~~~~~  763 (768)
                          .+....||+||.||+.|++.|+..|...+.|....|++|+..+||..++|||||||||||.||.++..+.
T Consensus       162 ----~gd~~nKRPRTTItAKqLETLK~AYn~SpKPARHVREQLsseTGLDMRVVQVWFQNRRAKEKRLKKDAGR  231 (383)
T KOG4577|consen  162 ----EGDASNKRPRTTITAKQLETLKQAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGR  231 (383)
T ss_pred             ----ccccccCCCcceeeHHHHHHHHHHhcCCCchhHHHHHHhhhccCcceeehhhhhhhhhHHHHhhhhhcch
Confidence                1123468999999999999999999999999999999999999999999999999999999998877654



>KOG1701|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query768
2jtn_A182 Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl 5e-14
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 9e-14
3mmk_A169 The Structural Basis For Partial Redundancy In A Cl 1e-13
2dmq_A80 Solution Structure Of The Homeobox Domain Of LimHOM 6e-13
2da3_A80 Solution Structure Of The Third Homeobox Domain Of 5e-12
1bw5_A66 The Nmr Solution Structure Of The Homeodomain Of Th 5e-08
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 8e-07
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 1e-06
2l6y_B96 Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 3e-06
2lxd_A125 Backbone 1h, 13c, And 15n Chemical Shift Assignment 4e-06
1rut_X188 Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L 4e-06
2dfy_X195 Crystal Structure Of A Cyclized Protein Fusion Of L 4e-06
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 6e-06
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 6e-06
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 1e-05
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 1e-05
2xjy_A131 Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 2e-05
2da2_A70 Solution Structure Of The Second Homeobox Domain Of 8e-05
2da2_A70 Solution Structure Of The Second Homeobox Domain Of 8e-05
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 8e-05
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 8e-05
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 9e-05
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 1e-04
2da1_A70 Solution Structure Of The First Homeobox Domain Of 1e-04
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 2e-04
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 4e-04
>pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 Back     alignment and structure

Iteration: 1

Score = 76.6 bits (187), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 1/63 (1%) Query: 612 FRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFALHED-RVLCK 670 F+ FG KC+ C GI + VR+A+D VYHL CFAC CKRQL+TG+EF L ED R++CK Sbjct: 115 FKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCK 174 Query: 671 SHY 673 + Y Sbjct: 175 ADY 177
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure
>pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 Back     alignment and structure
>pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 Back     alignment and structure
>pdb|2DA3|A Chain A, Solution Structure Of The Third Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 80 Back     alignment and structure
>pdb|1BW5|A Chain A, The Nmr Solution Structure Of The Homeodomain Of The Rat Insulin Gene Enhancer Protein Isl-1, 50 Structures Length = 66 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2L6Y|B Chain B, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 96 Back     alignment and structure
>pdb|2LXD|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For Lmo2(Lim2)- Ldb1(Lid) Length = 125 Back     alignment and structure
>pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 Back     alignment and structure
>pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|2XJY|A Chain A, Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 Crystal Form Length = 131 Back     alignment and structure
>pdb|2DA2|A Chain A, Solution Structure Of The Second Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 70 Back     alignment and structure
>pdb|2DA2|A Chain A, Solution Structure Of The Second Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 70 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2DA1|A Chain A, Solution Structure Of The First Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 70 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query768
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 1e-29
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 4e-28
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 9e-28
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-27
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-27
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 2e-26
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 5e-08
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-25
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-25
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 5e-25
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 2e-08
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 7e-25
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 4e-08
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 8e-25
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-07
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-23
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-23
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 5e-23
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 5e-23
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 6e-23
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 6e-23
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 3e-22
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 3e-22
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-20
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-20
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 6e-20
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-19
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 3e-19
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 5e-19
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 5e-19
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 6e-18
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 7e-18
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 7e-18
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-17
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 7e-17
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 6e-17
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 8e-10
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 7e-17
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-16
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-16
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-16
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-16
2xsd_C164 POU domain, class 3, transcription factor 1; trans 9e-16
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 5e-16
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-15
1e3o_C160 Octamer-binding transcription factor 1; transcript 8e-16
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-15
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 3e-15
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 7e-15
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 3e-15
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-12
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 5e-15
3d1n_I151 POU domain, class 6, transcription factor 1; prote 9e-15
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-14
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 2e-14
3f6q_B72 LIM and senescent cell antigen-like-containing dom 3e-14
1uhs_A72 HOP, homeodomain only protein; structural genomics 3e-14
1uhs_A72 HOP, homeodomain only protein; structural genomics 3e-14
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 4e-14
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 1e-13
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 5e-14
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 5e-14
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 6e-14
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-13
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-13
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 1e-13
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 1e-13
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-13
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-13
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 5e-13
2e19_A64 Transcription factor 8; homeobox domain, structura 5e-13
2e19_A64 Transcription factor 8; homeobox domain, structura 5e-13
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 1e-12
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 1e-12
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 2e-12
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 2e-12
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 2e-12
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 3e-12
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 9e-12
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 9e-12
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 1e-11
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 2e-11
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-11
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-11
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 2e-11
2cuq_A80 Four and A half LIM domains 3; structural genomics 2e-11
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 2e-11
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 6e-11
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 6e-11
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 7e-11
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 1e-10
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 2e-10
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 2e-10
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 2e-10
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-10
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-10
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 2e-10
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 9e-09
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 2e-10
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 4e-10
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 5e-10
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 8e-10
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 9e-10
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-09
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-08
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-09
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 4e-09
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 3e-09
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 6e-09
2co8_A82 NEDD9 interacting protein with calponin homology a 1e-08
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 2e-08
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 5e-08
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 4e-08
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 8e-08
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 5e-08
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 3e-07
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 5e-08
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-07
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-07
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 2e-07
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 2e-07
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 3e-07
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 3e-07
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 3e-07
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 4e-07
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 6e-06
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-07
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-07
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 6e-07
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 6e-07
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 7e-07
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 7e-07
3a01_A93 Homeodomain-containing protein; homeodomain, prote 8e-07
3a01_A93 Homeodomain-containing protein; homeodomain, prote 8e-07
1lfb_A99 Liver transcription factor (LFB1); transcription r 8e-07
1lfb_A99 Liver transcription factor (LFB1); transcription r 8e-07
1wh5_A80 ZF-HD homeobox family protein; structural genomics 1e-06
1wh5_A80 ZF-HD homeobox family protein; structural genomics 7e-06
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 1e-06
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 1e-05
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 2e-06
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 5e-06
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 3e-06
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 3e-06
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 3e-06
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 3e-06
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 5e-06
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 5e-06
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 6e-06
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 6e-06
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 8e-06
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 8e-06
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 9e-06
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 9e-06
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 1e-05
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 5e-05
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 1e-05
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 1e-04
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-05
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-05
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 2e-05
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 2e-05
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-05
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 3e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 3e-05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 4e-05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 4e-05
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 5e-05
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 5e-05
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 1e-04
2cor_A79 Pinch protein; LIM domain, particularly interestin 1e-04
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 2e-04
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 2e-04
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 3e-04
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 3e-04
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 3e-04
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 3e-04
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 3e-04
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 3e-04
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 6e-04
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 6e-04
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query768
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.88
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.79
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.78
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.78
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.76
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.67
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.66
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.66
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.64
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.64
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.63
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.63
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.62
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.62
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.62
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.62
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.62
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.62
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.61
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.61
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.61
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.61
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.61
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.6
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.6
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.6
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.6
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.6
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.6
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.6
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.6
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.6
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.6
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.6
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.6
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.59
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.59
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.59
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.59
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.59
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.59
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.58
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.58
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.57
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.57
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.56
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.56
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.56
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.56
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.56
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.56
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.56
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.55
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.55
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.55
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.55
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.55
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.55
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.55
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.55
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.55
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.55
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.54
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.54
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.54
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.54
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.54
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.54
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.54
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.54
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.54
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.54
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.54
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.53
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.53
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.53
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.53
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.53
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.53
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.53
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.53
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.52
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.52
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.52
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.51
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.51
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.51
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.51
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.51
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.51
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.51
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.51
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.5
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.5
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.5
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.5
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.5
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.5
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.5
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.5
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.49
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.49
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.49
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.49
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.49
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.48
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.48
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.48
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.47
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.47
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.47
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.47
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.47
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.47
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.46
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.46
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.46
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.46
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.45
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.45
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.45
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.45
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.45
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.45
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.45
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.44
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.44
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.43
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.43
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.42
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.42
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.42
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.42
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.41
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.41
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.4
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.4
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.4
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.39
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.39
2e19_A64 Transcription factor 8; homeobox domain, structura 99.38
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.38
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.38
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.38
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.38
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.38
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.37
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.37
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.37
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.37
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.35
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.34
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.33
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.33
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.32
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.31
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.31
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.3
2e19_A64 Transcription factor 8; homeobox domain, structura 99.3
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.3
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.29
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.29
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.29
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.26
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.25
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.23
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.23
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.22
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.21
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.2
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.19
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.18
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.18
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.18
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.17
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.17
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.15
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.11
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.1
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.09
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.09
2co8_A82 NEDD9 interacting protein with calponin homology a 99.06
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.06
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.05
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.04
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.03
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.02
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.01
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.0
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.0
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.99
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 98.98
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 98.96
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 98.91
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 98.89
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 98.87
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 98.87
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.84
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.75
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 98.73
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 98.69
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 98.66
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 98.63
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.62
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 98.57
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 98.54
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 98.52
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 98.5
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.49
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 98.47
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 98.43
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 98.4
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 98.4
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 98.39
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 98.39
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 98.38
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 98.36
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 98.36
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.35
2cuq_A80 Four and A half LIM domains 3; structural genomics 98.35
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 98.34
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 98.31
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 98.28
2cor_A79 Pinch protein; LIM domain, particularly interestin 98.23
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 98.23
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 98.23
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 98.2
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 98.19
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 98.12
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 98.07
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 98.05
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 98.05
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 97.95
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 97.87
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 97.84
3f6q_B72 LIM and senescent cell antigen-like-containing dom 97.78
2co8_A82 NEDD9 interacting protein with calponin homology a 97.77
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 97.67
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 97.38
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 97.25
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 96.4
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 80.99
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
Probab=99.88  E-value=1.2e-24  Score=213.98  Aligned_cols=157  Identities=27%  Similarity=0.429  Sum_probs=125.8

Q ss_pred             ccchhhhhhhhhhHH-HHHhhcccccccccccceEEEeccccccccccccccccccccccCCCCcceeecccccccccch
Q psy17256        530 HLEFHSFLKRIALVL-SEKWKKMYGHVLSWLRVRTEFSILKAVSLRLRGTRQIVKPYGFDDGAGLMYIRVRILLKGRLSV  608 (768)
Q Consensus       530 g~~C~~c~k~Ia~~~-~~~~~~~~s~~~~wh~~~~~c~~c~~~~~~~~g~r~~~~~~~~~dg~~~~~~~~~~~~c~~yC~  608 (768)
                      .+.|..|.+.|.+.. +.+.|+      .||+.||.|+.|+..+.                  +..|.+++.+    ||.
T Consensus         6 ~~~C~~C~~~I~~~~~~~a~~~------~wH~~CF~C~~C~~~L~------------------~~~f~~~g~~----yC~   57 (169)
T 2rgt_A            6 IPMCAGCDQHILDRFILKALDR------HWHSKCLKCSDCHVPLA------------------ERCFSRGESV----YCK   57 (169)
T ss_dssp             -CBBSSSSSBCCSSSCEECSSC------EECTTTSBCTTTCCBCC------------------SCCEESSSCE----ECH
T ss_pred             CCccccCCCccCCcEEEEECCc------EEccccCccCCCCCcCC------------------CCCcccCCee----eec
Confidence            356999999999874 456677      99999999999995433                  1226778888    456


Q ss_pred             hhhhhhcccccccCCCCCCCCcceeeecCceecccCccccccccccCCCCceEe-ecCcccccccccccccCCcccCCCC
Q psy17256        609 LICFRSFGAKCSKCCRGIASSDWVRKARDHVYHLACFACEACKRQLSTGEEFAL-HEDRVLCKSHYLELVDGGTTSSDDG  687 (768)
Q Consensus       609 ~~y~~~f~~~C~~C~~~I~~~e~~~~a~~~~~H~~CF~C~~C~~~L~~G~~f~~-~~g~~~C~~~y~e~~~~~~~s~~~g  687 (768)
                      .||.++|+++|.+|+++|.+.+.++.|+++.||.+||+|..|+++|..|+.|+. .++++||+.||.++...+.    + 
T Consensus        58 ~~y~~~f~~~C~~C~~~I~~~~~v~~a~~~~~H~~CF~C~~C~~~L~~g~~f~~~~~g~~~C~~c~~~~~~~~~----~-  132 (169)
T 2rgt_A           58 DDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQGGS----G-  132 (169)
T ss_dssp             HHHHHHHSCBCTTTCCBCCTTSEEEEETTEEEEGGGCBCTTTCCBCCTTCEEEECTTSCEEEHHHHHHHHHCC-------
T ss_pred             ccccccccccccccccccCCCcEEEEcCCceEeeCCCcCCCCCCCCCCCCceEEccCCeEECHHHHHHHhhccC----C-
Confidence            999999999999999999988888999999999999999999999977888865 5789999999988776421    0 


Q ss_pred             CCcccccCCCccccccccccHHHHHHHhhccccCCCCCHH
Q psy17256        688 ADSESSHSKSKAKRVRTTFTEEQLQVLQANFQLDSNPDGQ  727 (768)
Q Consensus       688 ~~~~~~~~~~k~rr~Rt~~s~~Ql~~Le~~F~~~~~p~~~  727 (768)
                              ..+.+|+||.|+..|++.|+..|+.++||...
T Consensus       133 --------~~~~~rprt~~~~~q~~~l~~~f~~~~~~~~~  164 (169)
T 2rgt_A          133 --------GSGGSGGGTPMVAASPERHDGGLQANPVEVQS  164 (169)
T ss_dssp             ----------------EEEECCCCEECCSSCCCCCCCCCC
T ss_pred             --------CCCCcCCCCcccHHHHHHHHHHHhCCCCcccc
Confidence                    13467899999999999999999999998754



>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 768
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 7e-17
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 7e-17
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 1e-15
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 1e-15
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 1e-15
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 1e-15
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-15
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-15
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-15
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 5e-15
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-15
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-15
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-15
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-15
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 4e-15
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 6e-15
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 5e-15
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 5e-15
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-14
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-14
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-14
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-14
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 1e-14
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 1e-14
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-14
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-14
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-14
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-14
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 6e-14
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 6e-14
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 1e-13
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 1e-13
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 1e-13
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 1e-13
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-13
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-13
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 2e-13
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 2e-13
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-13
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-13
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 9e-13
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 9e-13
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 1e-12
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 1e-12
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-12
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-12
d1rutx331 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus 3e-12
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 4e-12
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 4e-12
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 7e-12
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 7e-12
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-11
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-11
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 4e-11
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 4e-11
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5e-10
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5e-10
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 7e-10
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 7e-10
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-08
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-08
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 7e-08
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 1e-07
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Insulin gene enhancer protein isl-1
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 73.3 bits (180), Expect = 7e-17
 Identities = 26/60 (43%), Positives = 36/60 (60%)

Query: 59  KAKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKKH 118
           K  RVRT   E+QL  L+  +  +  PD    E++ ++TGLS RV +VWFQN R + KK 
Sbjct: 2   KTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKR 61


>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 31 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query768
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.7
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.68
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.68
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.67
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.67
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.67
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.66
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.65
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.65
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.64
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.64
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.64
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.64
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.63
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.63
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.62
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.62
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.62
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.61
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.61
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.61
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.61
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.59
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.59
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.59
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.59
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.59
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.58
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.58
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.57
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.56
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.56
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.55
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.55
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.54
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.53
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.52
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.52
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.52
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.51
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.51
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.49
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.48
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.47
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.45
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.45
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.45
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.44
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.43
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.39
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.38
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.37
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.34
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.31
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.29
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.28
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.28
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.24
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.23
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.2
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.18
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.15
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.1
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.67
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.59
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.42
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.31
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 98.06
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.98
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.97
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 97.78
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 97.72
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.59
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.56
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.45
d1g47a235 Pinch (particularly interesting new Cys-His) prote 97.44
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.42
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.3
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 97.13
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.94
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.91
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 96.9
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 96.88
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 96.8
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 96.73
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.62
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 96.59
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 96.47
d1g47a235 Pinch (particularly interesting new Cys-His) prote 96.45
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 96.36
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.24
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 96.2
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 96.18
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.18
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 96.12
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.96
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 95.94
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.87
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 95.83
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 95.45
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 95.4
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 95.4
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 95.37
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 95.22
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 95.21
d2co8a236 Nedd9 interacting protein with calponin homology, 95.01
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 94.74
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 94.72
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 94.49
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 93.62
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 93.42
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 93.22
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 92.76
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 92.74
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 92.52
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 92.26
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 92.18
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 92.17
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 91.79
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 91.65
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 91.25
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 90.94
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 90.58
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 90.39
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 90.38
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 90.25
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 90.18
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 89.93
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 89.88
d1g47a135 Pinch (particularly interesting new Cys-His) prote 89.67
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 89.32
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 88.92
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 88.9
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 88.67
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 88.22
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 88.22
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 86.7
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 84.79
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 83.8
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 82.9
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 82.5
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 81.99
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.70  E-value=1.9e-18  Score=136.06  Aligned_cols=58  Identities=28%  Similarity=0.532  Sum_probs=55.6

Q ss_pred             CCCCCccCCHHHHHHHHHhhhhCCCCCHHHHHHHHHHcCCCcccccccccccHHHHhh
Q psy17256         60 AKRVRTTFTEEQLQVLQANFQLDSNPDGQDLERIAQITGLSKRVTQVWFQNSRARQKK  117 (768)
Q Consensus        60 ~rr~Rt~~t~~Ql~~Le~~F~~~~~p~~~~r~~la~~l~l~~~~vqvWFqNrRak~k~  117 (768)
                      +||.||.||..|+.+||..|..++||+..+|++||..+||++.+|+|||||||+|+||
T Consensus         1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            3677999999999999999999999999999999999999999999999999999986



>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure