Diaphorina citri psyllid: psy1726

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------

MDSHSAATLPSRYVTSAHNMIRDLGLSTGVKGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDTCTADCRQLNTQDYMDLLWTTLAEFPGNYYVFIRNRATYISQS

cccccccccccccEEccccHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHcccccccc

************YVTSAHNMIRDLGLSTGVKGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEASDT*C****************TCTADCRQLNTQDYMDLLWTTLAEFPGNYYVFIRNRATYI***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDSHSAATLPSRYVTSAHNMIRDLGLSTGVKGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDTCTADCRQLNTQDYMDLLWTTLAEFPGNYYVFIRNRATYISQS

Annotation	Function Description	Confidence Level	Reference Protein
Synaptic vesicle 2-related protein		confident	Q9Z2I7
Synaptic vesicle 2-related protein		confident	Q8N4V2
Synaptic vesicle 2-related protein		confident	Q8BFT9

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008021 [CC]	synaptic vesicle	probable	GO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136

No EC number assigned to the protein, probably not an enzyme!

Template: 3O7Q, chain A
Confidence level:probable
Coverage over the Query: 28-76,103-135
View the alignment between query and template
View the model in PyMOL