Psyllid ID: psy1726


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MDSHSAATLPSRYVTSAHNMIRDLGLSTGVKGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDTCTADCRQLNTQDYMDLLWTTLAEFPGNYYVFIRNRATYISQS
cccccccccccccEEccccHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHcccccccc
cccccccccccHHHHHHHHHHHHcccccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHHccccHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHEHHEHHHHcEEEccc
mdshsaatlpsryvTSAHNMIRDLGLSTGVKGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTelfeasdtrcsespiaaasgmfkpvdtctadcrqlNTQDYMDLLWTTlaefpgnyyVFIRNRATYISQS
mdshsaatlpsryvtSAHNMIRDLGLSTGVKGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDTCTADCRQLNTQDYMDLLWTTLAEFPGNYYVFIRNRATYISQS
MDSHSAATLPSRYVTSAHNMIRDLGLSTGVKGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDTCTADCRQLNTQDYMDLLWTTLAEFPGNYYVFIRNRATYISQS
************YVTSAHNMIRDLGLSTGVKGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDTCTADCRQLNTQDYMDLLWTTLAEFPGNYYVFIRNRATYI***
********************************LFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEAS***********************ADCRQLNTQDYMDLLWTTLAEFPGNYYVFIRNRATYI***
*********PSRYVTSAHNMIRDLGLSTGVKGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDTCTADCRQLNTQDYMDLLWTTLAEFPGNYYVFIRNRATYISQS
*********PSRYVTSAHNMIRDLGLSTGVKGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEASDT*C****************TCTADCRQLNTQDYMDLLWTTLAEFPGNYYVFIRNRATYIS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSHSAATLPSRYVTSAHNMIRDLGLSTGVKGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDTCTADCRQLNTQDYMDLLWTTLAEFPGNYYVFIRNRATYISQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query137 2.2.26 [Sep-21-2011]
Q8BFT9 548 Synaptic vesicle 2-relate yes N/A 0.423 0.105 0.515 9e-12
Q1JP63 548 Synaptic vesicle 2-relate yes N/A 0.423 0.105 0.515 1e-11
Q9Z2I7 548 Synaptic vesicle 2-relate yes N/A 0.423 0.105 0.515 1e-11
Q8N4V2 548 Synaptic vesicle 2-relate yes N/A 0.423 0.105 0.515 1e-11
Q5R5T8 548 Synaptic vesicle 2-relate yes N/A 0.423 0.105 0.515 1e-11
Q2XWK0 548 Synaptic vesicle 2-relate N/A N/A 0.430 0.107 0.538 2e-11
P30638 520 Putative transporter ZK63 yes N/A 0.423 0.111 0.462 9e-06
>sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 34/66 (51%), Positives = 44/66 (66%), Gaps = 8/66 (12%)

Query: 57  AFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDT-CTADCRQLNTQDYMDLLWTT 115
           AF YYG+VL+TTELF+A D       + + S   K V+  C+  C  L+ +DYMDLLWTT
Sbjct: 328 AFSYYGLVLLTTELFQAGD-------VCSISSRKKAVEAKCSLACEYLSKEDYMDLLWTT 380

Query: 116 LAEFPG 121
           L+EFPG
Sbjct: 381 LSEFPG 386





Mus musculus (taxid: 10090)
>sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 Back     alignment and function description
>sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 Back     alignment and function description
>sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 Back     alignment and function description
>sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 Back     alignment and function description
>sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 Back     alignment and function description
>sp|P30638|YOU1_CAEEL Putative transporter ZK637.1 OS=Caenorhabditis elegans GN=ZK637.1 PE=3 SV=5 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
193617990 510 PREDICTED: synaptic vesicle 2-related pr 0.708 0.190 0.475 2e-16
357614380 430 putative sugar transporter [Danaus plexi 0.802 0.255 0.380 2e-13
242008957 507 sugar transporter, putative [Pediculus h 0.554 0.149 0.460 4e-13
443727495 539 hypothetical protein CAPTEDRAFT_220893 [ 0.554 0.141 0.465 2e-12
340718001 517 PREDICTED: synaptic vesicle 2-related pr 0.416 0.110 0.594 6e-12
350400543 517 PREDICTED: synaptic vesicle 2-related pr 0.416 0.110 0.594 6e-12
383847537 516 PREDICTED: synaptic vesicle 2-related pr 0.430 0.114 0.597 8e-12
332028284 517 Synaptic vesicle 2-related protein [Acro 0.437 0.116 0.582 1e-11
322800858 302 hypothetical protein SINV_12690 [Solenop 0.437 0.198 0.582 1e-11
291231793 524 PREDICTED: synaptic vesicle 2-related pr 0.715 0.187 0.392 1e-11
>gi|193617990|ref|XP_001945003.1| PREDICTED: synaptic vesicle 2-related protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 67/103 (65%), Gaps = 6/103 (5%)

Query: 31  KGLFTTFQSYPSRINKAVFLFHRTVCAFCYYGVVLMTTELFEAS--DTRCSESPIAAASG 88
           +G FT       R++  +  F   VCAFCYYG+VLM+T LFE+S  +  CS +     SG
Sbjct: 281 RGSFTDLLLPQLRVSSILLWFIWLVCAFCYYGIVLMSTGLFESSYNNRTCSAN---LDSG 337

Query: 89  MFKPVDTCTADCRQLNTQDYMDLLWTTLAEFPGNYY-VFIRNR 130
           +FK V +CTA+   L T+DY+DLLWTTLAEFPG +  +F+ +R
Sbjct: 338 IFKTVQSCTAESHYLTTRDYIDLLWTTLAEFPGIFATIFVIDR 380




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357614380|gb|EHJ69047.1| putative sugar transporter [Danaus plexippus] Back     alignment and taxonomy information
>gi|242008957|ref|XP_002425260.1| sugar transporter, putative [Pediculus humanus corporis] gi|212509016|gb|EEB12522.1| sugar transporter, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|443727495|gb|ELU14236.1| hypothetical protein CAPTEDRAFT_220893 [Capitella teleta] Back     alignment and taxonomy information
>gi|340718001|ref|XP_003397461.1| PREDICTED: synaptic vesicle 2-related protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350400543|ref|XP_003485871.1| PREDICTED: synaptic vesicle 2-related protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383847537|ref|XP_003699409.1| PREDICTED: synaptic vesicle 2-related protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332028284|gb|EGI68331.1| Synaptic vesicle 2-related protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322800858|gb|EFZ21708.1| hypothetical protein SINV_12690 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|291231793|ref|XP_002735848.1| PREDICTED: synaptic vesicle 2-related protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
UNIPROTKB|F6XK47 483 SVOP "Uncharacterized protein" 0.423 0.120 0.545 1.5e-11
UNIPROTKB|E2QZ16 548 SVOP "Uncharacterized protein" 0.423 0.105 0.545 1.8e-11
UNIPROTKB|G3MZU5 547 SVOP "Synaptic vesicle 2-relat 0.423 0.106 0.545 2.3e-11
UNIPROTKB|Q1JP63 548 SVOP "Synaptic vesicle 2-relat 0.423 0.105 0.545 2.3e-11
UNIPROTKB|F1RGB1 548 SVOP "Uncharacterized protein" 0.423 0.105 0.545 2.3e-11
MGI|MGI:1915916 548 Svop "SV2 related protein" [Mu 0.423 0.105 0.545 2.3e-11
RGD|620277 548 Svop "SV2 related protein" [Ra 0.423 0.105 0.545 2.3e-11
UNIPROTKB|F1LPX1 548 Svop "Synaptic vesicle 2-relat 0.423 0.105 0.545 2.3e-11
UNIPROTKB|Q9Z2I7 548 Svop "Synaptic vesicle 2-relat 0.423 0.105 0.545 2.3e-11
UNIPROTKB|Q8N4V2 548 SVOP "Synaptic vesicle 2-relat 0.423 0.105 0.515 4.9e-11
UNIPROTKB|F6XK47 SVOP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 166 (63.5 bits), Expect = 1.5e-11, P = 1.5e-11
 Identities = 36/66 (54%), Positives = 44/66 (66%)

Query:    57 AFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDT-CTADCRQLNTQDYMDLLWTT 115
             AF YYG+VL+TTELF+A D  CS       S   K V+  C+  C  L+ +DYMDLLWTT
Sbjct:   263 AFSYYGLVLLTTELFQAGDV-CS------ISSQKKAVEAKCSLACEYLSEEDYMDLLWTT 315

Query:   116 LAEFPG 121
             L+EFPG
Sbjct:   316 LSEFPG 321




GO:0016021 "integral to membrane" evidence=IEA
GO:0022857 "transmembrane transporter activity" evidence=IEA
UNIPROTKB|E2QZ16 SVOP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZU5 SVOP "Synaptic vesicle 2-related protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JP63 SVOP "Synaptic vesicle 2-related protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RGB1 SVOP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1915916 Svop "SV2 related protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620277 Svop "SV2 related protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPX1 Svop "Synaptic vesicle 2-related protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Z2I7 Svop "Synaptic vesicle 2-related protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N4V2 SVOP "Synaptic vesicle 2-related protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8N4V2SVOP_HUMANNo assigned EC number0.51510.42330.1058yesN/A
Q9Z2I7SVOP_RATNo assigned EC number0.51510.42330.1058yesN/A
Q1JP63SVOP_BOVINNo assigned EC number0.51510.42330.1058yesN/A
Q8BFT9SVOP_MOUSENo assigned EC number0.51510.42330.1058yesN/A
Q5R5T8SVOP_PONABNo assigned EC number0.51510.42330.1058yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 137
KOG0253|consensus 528 99.66
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.14
TIGR00898 505 2A0119 cation transport protein. 98.24
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 98.0
KOG0255|consensus 521 97.67
PRK10642 490 proline/glycine betaine transporter; Provisional 97.27
PRK10406 432 alpha-ketoglutarate transporter; Provisional 96.54
KOG0569|consensus 485 96.47
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 96.43
KOG0254|consensus 513 96.41
PRK12307 426 putative sialic acid transporter; Provisional 96.3
TIGR00895398 2A0115 benzoate transport. 96.24
PRK15075 434 citrate-proton symporter; Provisional 96.15
TIGR00901356 2A0125 AmpG-related permease. 95.94
PLN00028 476 nitrate transmembrane transporter; Provisional 95.75
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 95.55
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 95.4
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 95.36
PRK09952 438 shikimate transporter; Provisional 95.34
PRK10504 471 putative transporter; Provisional 95.33
PRK03893 496 putative sialic acid transporter; Provisional 95.27
PRK03699 394 putative transporter; Provisional 95.24
PRK09705 393 cynX putative cyanate transporter; Provisional 95.22
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 95.17
KOG0252|consensus 538 95.09
TIGR00897 402 2A0118 polyol permease family. This family of prot 95.06
PRK15462 493 dipeptide/tripeptide permease D; Provisional 95.04
PRK11663 434 regulatory protein UhpC; Provisional 94.99
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 94.8
PRK12307 426 putative sialic acid transporter; Provisional 94.5
TIGR00893 399 2A0114 d-galactonate transporter. 94.44
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 94.41
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 94.38
TIGR00895 398 2A0115 benzoate transport. 94.3
PRK03699 394 putative transporter; Provisional 94.2
PRK11652 394 emrD multidrug resistance protein D; Provisional 93.86
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 93.84
TIGR00891 405 2A0112 putative sialic acid transporter. 93.84
PRK10077 479 xylE D-xylose transporter XylE; Provisional 93.74
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 93.67
PLN00028 476 nitrate transmembrane transporter; Provisional 93.57
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 93.54
PRK10054 395 putative transporter; Provisional 93.54
TIGR00891405 2A0112 putative sialic acid transporter. 93.47
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 93.09
TIGR00896355 CynX cyanate transporter. This family of proteins 92.84
TIGR00897 402 2A0118 polyol permease family. This family of prot 92.72
PRK03633 381 putative MFS family transporter protein; Provision 92.65
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 92.33
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 92.23
PRK09528 420 lacY galactoside permease; Reviewed 92.13
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 91.61
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 91.54
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 91.31
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 91.3
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 90.91
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 90.61
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 90.48
PRK09874 408 drug efflux system protein MdtG; Provisional 90.38
PRK15403 413 multidrug efflux system protein MdtM; Provisional 90.19
PRK11663 434 regulatory protein UhpC; Provisional 90.07
PRK15075 434 citrate-proton symporter; Provisional 90.0
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 89.91
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 89.85
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 89.7
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 89.54
PF13347 428 MFS_2: MFS/sugar transport protein 89.47
PRK05122 399 major facilitator superfamily transporter; Provisi 89.45
PRK03545 390 putative arabinose transporter; Provisional 89.03
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 88.87
PRK03893 496 putative sialic acid transporter; Provisional 88.84
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 88.8
PRK10133 438 L-fucose transporter; Provisional 88.61
PRK03633 381 putative MFS family transporter protein; Provision 88.43
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 88.39
PRK11010 491 ampG muropeptide transporter; Validated 87.88
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 87.48
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 86.97
PRK10213 394 nepI ribonucleoside transporter; Reviewed 86.26
PRK09584 500 tppB putative tripeptide transporter permease; Rev 86.0
PRK10207 489 dipeptide/tripeptide permease B; Provisional 85.78
PRK15011 393 sugar efflux transporter B; Provisional 85.22
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 85.13
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 85.08
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 84.96
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 84.85
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 84.66
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 84.11
PRK10091 382 MFS transport protein AraJ; Provisional 83.81
TIGR00881379 2A0104 phosphoglycerate transporter family protein 83.3
TIGR00900365 2A0121 H+ Antiporter protein. 83.24
PRK10406 432 alpha-ketoglutarate transporter; Provisional 83.23
TIGR00892 455 2A0113 monocarboxylate transporter 1. 83.2
PRK10473 392 multidrug efflux system protein MdtL; Provisional 82.83
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 82.76
TIGR00893 399 2A0114 d-galactonate transporter. 82.76
PRK11902 402 ampG muropeptide transporter; Reviewed 82.49
PRK11195 393 lysophospholipid transporter LplT; Provisional 82.42
PRK09952 438 shikimate transporter; Provisional 82.32
PRK12382 392 putative transporter; Provisional 82.25
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 82.05
PRK10489 417 enterobactin exporter EntS; Provisional 81.98
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 81.58
TIGR00900 365 2A0121 H+ Antiporter protein. 81.49
PRK14995 495 methyl viologen resistance protein SmvA; Provision 80.99
PRK10133 438 L-fucose transporter; Provisional 80.87
PRK03545 390 putative arabinose transporter; Provisional 80.86
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 80.64
KOG2533|consensus 495 80.21
>KOG0253|consensus Back     alignment and domain information
Probab=99.66  E-value=2.2e-16  Score=134.40  Aligned_cols=102  Identities=33%  Similarity=0.426  Sum_probs=83.3

Q ss_pred             ccccccccchhhhccccccchhHHHHHHHHH-HHHhhhHHHHHHHHhHHHHhhhccCccCCCccccccCCCCCCCccccc
Q psy1726          21 IRDLGLSTGVKGLFTTFQSYPSRINKAVFLF-HRTVCAFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDTCTAD   99 (137)
Q Consensus        21 ~~~~~~~~~i~~LF~~~~~~~~~r~~Tl~l~-iwf~~~~~YyGl~lw~P~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   99 (137)
                      .+++|   ++.+|+     +|.+||+|+++| +||+..|.|||+++...++++..+.|.-.+    +.  .....+|..+
T Consensus       310 ke~rg---~~~nLl-----sp~lrkttlllw~iwfgnafsyyg~VLlttelfqsgd~c~~~~----r~--~p~e~e~~~~  375 (528)
T KOG0253|consen  310 KEVRG---GTTNLL-----SPKLRKTTLLLWRIWFGNAFSYYGSVLLTTELFQSGDACPLYN----RF--LPTELETRAN  375 (528)
T ss_pred             ccccc---chHhhc-----ChHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHhccCccccch----hc--chhHHHhhhc
Confidence            34466   789999     999999999999 999999999999999999998776553211    10  0122235556


Q ss_pred             cccCChhhHHHHHHHHHHHHHHHHH-HHHHHHhcCCCC
Q psy1726         100 CRQLNTQDYMDLLWTTLAEFPGNYY-VFIRNRATYISQ  136 (137)
Q Consensus       100 c~~l~~~~y~~~~i~~l~eipG~il-~llidriGRK~~  136 (137)
                      |+.+...+|++.++++++|+||.++ ++++||+|||..
T Consensus       376 c~~s~~~dYrdllitslaefPGlLIt~~iverlGRKkT  413 (528)
T KOG0253|consen  376 CPLSVAKDYRDLLITSLAEFPGLLITGVIVERLGRKKT  413 (528)
T ss_pred             CCccchhHHHHHHHHHHhhCCchhHHHHHHHHhcchhH
Confidence            8888889999999999999999999 999999999963



>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 96.68
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 95.09
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 94.45
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 93.87
2xut_A 524 Proton/peptide symporter family protein; transport 92.98
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 92.86
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 92.83
2cfq_A 417 Lactose permease; transport, transport mechanism, 92.3
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 91.87
2cfq_A 417 Lactose permease; transport, transport mechanism, 89.13
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 80.58
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=96.68  E-value=0.0031  Score=50.92  Aligned_cols=64  Identities=5%  Similarity=-0.017  Sum_probs=48.7

Q ss_pred             HHHHHH-HHHhhhHHHHHHHHhHHHHhhhccCccCCCccccccCCCCCCCccccccccCChhhHHHHHHHHHHHHHHHHH
Q psy1726          46 KAVFLF-HRTVCAFCYYGVVLMTTELFEASDTRCSESPIAAASGMFKPVDTCTADCRQLNTQDYMDLLWTTLAEFPGNYY  124 (137)
Q Consensus        46 ~Tl~l~-iwf~~~~~YyGl~lw~P~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~l~~~~y~~~~i~~l~eipG~il  124 (137)
                      ..+.++ .++....+++.+..+.|.++...+.                          .....+...++.++..+++.++
T Consensus       278 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~~  331 (491)
T 4gc0_A          278 IVIGVMLSIFQQFVGINVVLYYAPEVFKTLGA--------------------------STDIALLQTIIVGVINLTFTVL  331 (491)
T ss_dssp             HHHHHHHHHHHHHTCHHHHHHHHHHHHHHSSC--------------------------CHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhhhHHHhcchHHHHhcCC--------------------------CccchhhHHHHHHHHHHHHHHH
Confidence            344455 6777777888888999988765432                          1234466778889999999999


Q ss_pred             -HHHHHHhcCCC
Q psy1726         125 -VFIRNRATYIS  135 (137)
Q Consensus       125 -~llidriGRK~  135 (137)
                       .+++||+|||+
T Consensus       332 ~~~l~dr~Grr~  343 (491)
T 4gc0_A          332 AIMTVDKFGRKP  343 (491)
T ss_dssp             HHHHHHHHCSHH
T ss_pred             HHHHHHhhcCcc
Confidence             99999999996



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 93.18
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 92.69
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 92.46
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: LacY-like proton/sugar symporter
domain: Lactose permease
species: Escherichia coli [TaxId: 562]
Probab=93.18  E-value=0.18  Score=35.99  Aligned_cols=24  Identities=4%  Similarity=-0.112  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHH-HHHHHHhcCCC
Q psy1726         112 LWTTLAEFPGNYY-VFIRNRATYIS  135 (137)
Q Consensus       112 ~i~~l~eipG~il-~llidriGRK~  135 (137)
                      .+..++.+.+.++ +.+.||+|||+
T Consensus        50 s~~~l~~~i~~~~~G~l~Dr~grr~   74 (417)
T d1pv7a_          50 AAISLFSLLFQPLFGLLSDKLGLRK   74 (417)
T ss_dssp             HHHHHHHHHTHHHHHHHHHHHTTCT
T ss_pred             HHHHHHHHHHHHHHHHHHHHhCchH
Confidence            3456667777778 99999999997



>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure