Diaphorina citri psyllid: psy17274


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MFSLTGVYGDVLRVKILYNKKDSALIQMAESHQAHLAMMHMDKLRVFGKQMRVMISKHQAVQLPKEGQPDAGLTKDYTASPLHRFKKPGSKNFQNIYPPSPTLHLSNIPASVTEDELKEAFTEKGFTVKGFKFFPKDRKMALLQLDSIEEAITALIQMHNHQLSEQSHLRVSFSKSNIQDIRDN
ccccccccccEEEEEEEEEcccEEEEEEccHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEccccccEEEEEcccHHHHHHHHHHHccccccccccEEEEEccccccccccc
MFSLTGVYGDVLRVKILYNKKDSALIQMAESHQAHLAMMHMDKLRVFGKQMRVMISKHQ*************************************YPPSPTLHLSNIPASVTEDELKEAFTEKGFTVKGFKFFPKDRKMALLQLDSIEEAITALIQMHNHQLSEQSHLRVSF***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSLTGVYGDVLRVKILYNKKDSALIQMAESHQAHLAMMHMDKLRVFGKQMRVMISKHQAVQLPKEGQPDAGLTKDYTASPLHRFKKPGSKNFQNIYPPSPTLHLSNIPASVTEDELKEAFTEKGFTVKGFKFFPKDRKMALLQLDSIEEAITALIQMHNHQLSEQSHLRVSFSKSNIQDIRDN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polypyrimidine tract-binding protein 1 Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA. Represses the splicing of MAPT/Tau exon 10.confidentQ8WN55
Polypyrimidine tract-binding protein 3 RNA-binding protein that mediates pre-mRNA alternative splicing regulation. Plays a role in the regulation of cell proliferation, differentiation and migration. Positive regulator of EPO-dependent erythropoiesis. Participates in cell differentiation regulation by repressing tissue-specific exons. Promotes Fas exon 6 skipping. Binds RNA, preferentially to both poly(G) and poly(U).confidentQ9Z118
Polypyrimidine tract-binding protein 3 RNA-binding protein that mediates pre-mRNA alternative splicing regulation. Plays a role in the regulation of cell proliferation, differentiation and migration. Positive regulator of EPO-dependent erythropoiesis. Participates in cell differentiation regulation by repressing tissue-specific exons. Promotes Fas exon 6 skipping. Binds RNA, preferentially to both poly(G) and poly(U).confidentQ8BHD7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003730 [MF]mRNA 3'-UTR bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0000900 [MF]translation repressor activity, nucleic acid bindingprobableGO:0090079, GO:0003676, GO:0097159, GO:0030371, GO:0003674, GO:0005488, GO:0045182, GO:1901363
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0007319 [BP]negative regulation of oskar mRNA translationprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0050789, GO:0051248, GO:0010605, GO:0019222, GO:0010608, GO:0051246, GO:2000113, GO:0065007, GO:0031326, GO:0048519, GO:0010468, GO:0046011, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032269, GO:0032268, GO:0010556, GO:0017148, GO:0006417, GO:0010558, GO:0048523
GO:0008103 [BP]oocyte microtubule cytoskeleton polarizationprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0007163, GO:0000226, GO:0007309, GO:0007308, GO:0009798, GO:0010259, GO:0007275, GO:0044699, GO:0007389, GO:0030952, GO:0030951, GO:0048869, GO:0071840, GO:0016043, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0016325, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0044702, GO:0044763, GO:0022412, GO:0000003, GO:0006996, GO:0044767, GO:0007017, GO:0007010, GO:0044707, GO:0003006, GO:0048856, GO:0008150
GO:2001020 [BP]regulation of response to DNA damage stimulusprobableGO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0048025 [BP]negative regulation of mRNA splicing, via spliceosomeprobableGO:0033119, GO:0009892, GO:0080090, GO:0019222, GO:0050684, GO:0050686, GO:0031323, GO:0048024, GO:0050789, GO:0010605, GO:0043484, GO:0019219, GO:0065007, GO:0048519, GO:0010468, GO:0031324, GO:0045934, GO:0060255, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:0051253, GO:0051252, GO:0048523
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0051148 [BP]negative regulation of muscle cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0051147, GO:0048519, GO:0050789, GO:0048523
GO:0005681 [CC]spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0008587 [BP]imaginal disc-derived wing margin morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0008586 [BP]imaginal disc-derived wing vein morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0007291 [BP]sperm individualizationprobableGO:0048610, GO:0048232, GO:0007286, GO:0048468, GO:0019953, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0000003, GO:0048869, GO:0007349, GO:0007276, GO:0030855, GO:0002064, GO:0048515, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0008150, GO:0022412, GO:0007281, GO:0044702, GO:0044707, GO:0003006, GO:0048856, GO:0048646, GO:0044763, GO:0009987
GO:0036002 [MF]pre-mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0000381 [BP]regulation of alternative mRNA splicing, via spliceosomeprobableGO:0051252, GO:0080090, GO:0019222, GO:0060255, GO:0050684, GO:0043484, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0048024, GO:0008150, GO:0010468
GO:0000380 [BP]alternative mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0006396, GO:0006397

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QM9, chain A
Confidence level:very confident
Coverage over the Query: 1-178
View the alignment between query and template
View the model in PyMOL