Diaphorina citri psyllid: psy17286


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MSVLKSDIDKRKQISVRGIADVENVTTVKKYFNRHLHFTLVKDRNVATPRDYYFVSSSIMSVLKSDIDKRKQISVRGIADVENVTTVKKYFNRHLHFTLVKDRNVATPRDYYFALAYAVRDNLVSRWIRTQQHYFENDPKRVYYLSLEYYMGRSLQNTMINLGIQSAIDEAMYQKIKNGEQTEEPDDWLRYGNPWEKARPEYMIPVNFYGRVAEIGKGKKYSYCLLRPKSSIANTRYLLFSVLFFPAVNDGDYIQAVLDRNLAENISRVLYPNDNNFGGKELRLKQEYFMCAATLQAEVL
ccccccccHHHcccccccccccccHHHHHHHccccEEEEEEccccccccccccccccccccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccccccccCEEccccCEEEEEccEEEEECcCECccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccHHHccHHHHHHHcccccccc
*************ISVRGIADVENVTTVKKYFNRHLHFTLVKDRNVATPRDYYFVSSSIM************ISVRGIADVENVTTVKKYFNRHLHFTLVKDRNVATPRDYYFALAYAVRDNLVSRWIRTQQHYFENDPKRVYYLSLEYYMGRSLQNTMINLGIQSAIDEAMYQKIKNGEQTEEPDDWLRYGNPWEKARPEYMIPVNFYGRVAEIGKGKKYSYCLLRPKSSIANTRYLLFSVLFFPAVNDGDYIQAVLDRNLAENISRVLYPNDNNFGGKELRLKQEYFMCAATLQAEVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVLKSDIDKRKQISVRGIADVENVTTVKKYFNRHLHFTLVKDRNVATPRDYYFVSSSIMSVLKSDIDKRKQISVRGIADVENVTTVKKYFNRHLHFTLVKDRNVATPRDYYFALAYAVRDNLVSRWIRTQQHYFENDPKRVYYLSLEYYMGRSLQNTMINLGIQSAIDEAMYQKIKNGEQTEEPDDWLRYGNPWEKARPEYMIPVNFYGRVAEIGKGKKYSYCLLRPKSSIANTRYLLFSVLFFPAVNDGDYIQAVLDRNLAENISRVLYPNDNNFGGKELRLKQEYFMCAATLQAEVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glycogen phosphorylase, muscle form Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.confidentP00489
Glycogen phosphorylase Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.confidentQ9XTL9
Glycogen phosphorylase, muscle form Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.confidentP11217

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016208 [MF]AMP bindingprobableGO:0043168, GO:0043169, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0030170 [MF]pyridoxal phosphate bindingprobableGO:0043168, GO:0003674, GO:0048037, GO:0005488, GO:0043167
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0030246 [MF]carbohydrate bindingprobableGO:0003674, GO:0005488
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0008184 [MF]glycogen phosphorylase activityprobableGO:0004645, GO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758
GO:0002060 [MF]purine nucleobase bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:0002054, GO:1901363
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0051591 [BP]response to cAMPprobableGO:1901700, GO:0009719, GO:0050896, GO:1901698, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0014074, GO:0046683, GO:0014070
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005980 [BP]glycogen catabolic processprobableGO:0044710, GO:0009251, GO:0006091, GO:0044247, GO:0044264, GO:0044262, GO:0044260, GO:0071704, GO:0006112, GO:0006073, GO:0044042, GO:0009987, GO:1901575, GO:0000272, GO:0008150, GO:0008152, GO:0044723, GO:0009056, GO:0009057, GO:0055114, GO:0044724, GO:0044275, GO:0044238, GO:0005975, GO:0015980, GO:0005977, GO:0005976, GO:0016052, GO:0044237, GO:0043170
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006874 [BP]cellular calcium ion homeostasisprobableGO:0019725, GO:0072507, GO:0072503, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0055074, GO:0030003, GO:0055065, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0016529 [CC]sarcoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0043229, GO:0044464, GO:0016528, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0006006 [BP]glucose metabolic processprobableGO:0044238, GO:0005975, GO:0005996, GO:0019318, GO:0071704, GO:0008150, GO:0008152, GO:0044723
GO:0019842 [MF]vitamin bindingprobableGO:0036094, GO:0003674, GO:0005488
GO:0032052 [MF]bile acid bindingprobableGO:0043168, GO:0097159, GO:0031406, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0005496, GO:0033293
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GJ4, chain A
Confidence level:very confident
Coverage over the Query: 72-300
View the alignment between query and template
View the model in PyMOL
Template: 2GJ4, chain A
Confidence level:confident
Coverage over the Query: 13-58
View the alignment between query and template
View the model in PyMOL