Psyllid ID: psy17289
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 336 | 2.2.26 [Sep-21-2011] | |||||||
| A6QQZ0 | 358 | Ganglioside-induced diffe | yes | N/A | 0.735 | 0.689 | 0.277 | 1e-15 | |
| O88741 | 358 | Ganglioside-induced diffe | yes | N/A | 0.738 | 0.692 | 0.270 | 3e-15 | |
| Q8TB36 | 358 | Ganglioside-induced diffe | yes | N/A | 0.735 | 0.689 | 0.273 | 4e-15 | |
| Q96MZ0 | 367 | Ganglioside-induced diffe | no | N/A | 0.645 | 0.591 | 0.241 | 2e-08 | |
| Q8VE33 | 370 | Ganglioside-induced diffe | no | N/A | 0.645 | 0.586 | 0.236 | 8e-08 | |
| P30347 | 257 | Protein LigF OS=Pseudomon | N/A | N/A | 0.208 | 0.272 | 0.385 | 4e-07 | |
| P28342 | 221 | Glutathione S-transferase | N/A | N/A | 0.217 | 0.330 | 0.426 | 4e-07 | |
| P57108 | 225 | Glutathione S-transferase | N/A | N/A | 0.217 | 0.324 | 0.386 | 6e-07 | |
| Q03425 | 145 | Glutathione S-transferase | N/A | N/A | 0.217 | 0.503 | 0.413 | 1e-06 | |
| P42760 | 208 | Glutathione S-transferase | yes | N/A | 0.264 | 0.427 | 0.382 | 6e-06 |
| >sp|A6QQZ0|GDAP1_BOVIN Ganglioside-induced differentiation-associated protein 1 OS=Bos taurus GN=GDAP1 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 84.0 bits (206), Expect = 1e-15, Method: Compositional matrix adjust.
Identities = 73/263 (27%), Positives = 131/263 (49%), Gaps = 16/263 (6%)
Query: 1 MTLHEKKLNFKTHLVNLASNEQYESWFLEVNPLGEVPVLVDGVKIIPDSKRIIQYVEDNF 60
+ + EK L + H V+L +E E WF+ +N GEVPVL+ G II ++ +II Y+E F
Sbjct: 42 LVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTF 101
Query: 61 -SNGYKRLLPTDMDSKM--DVIALRDEIDSLPVGLITKGAPHHPDFLLNPKSPFLPSNRA 117
RL+P D S V R+ +DSLP+ T G HP+ ++ P + R
Sbjct: 102 LDEKTPRLMP-DKGSMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTR- 159
Query: 118 FMMDNQSRKPQVIRKAADVNPSISDILLDKATRQEQFNKELNNVQNYEQALERVDEVMNR 177
+ ++K A+ NP + + + K R + + +NV+ ++ L+ +++V+++
Sbjct: 160 -IRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQ 218
Query: 178 IEAILIENNKDN--QSRKPQVIRKA---ADVNPSIS---DILLDKATRQEQFNKELNNVQ 229
+E L N++ + R+P + ++ ADV+ +++ L A R K N
Sbjct: 219 VETELQRRNEETPEEGRQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLET 278
Query: 230 NYEQALER--VDEVMNRIEAILI 250
YE+ L+R ++V+ + ILI
Sbjct: 279 YYERVLKRKTFNKVLGHVNNILI 301
|
Regulates the mitochondrial network by promoting mitochondrial fission. Bos taurus (taxid: 9913) |
| >sp|O88741|GDAP1_MOUSE Ganglioside-induced differentiation-associated protein 1 OS=Mus musculus GN=Gdap1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8TB36|GDAP1_HUMAN Ganglioside-induced differentiation-associated protein 1 OS=Homo sapiens GN=GDAP1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q96MZ0|GD1L1_HUMAN Ganglioside-induced differentiation-associated protein 1-like 1 OS=Homo sapiens GN=GDAP1L1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8VE33|GD1L1_MOUSE Ganglioside-induced differentiation-associated protein 1-like 1 OS=Mus musculus GN=Gdap1l1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P30347|LIGF_PSEPA Protein LigF OS=Pseudomonas paucimobilis GN=ligF PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P28342|GSTZ1_DIACA Glutathione S-transferase 1 OS=Dianthus caryophyllus GN=GST1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P57108|GSTZ_EUPES Glutathione S-transferase zeta class OS=Euphorbia esula PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q03425|GSTZ2_DIACA Glutathione S-transferase 2 (Fragment) OS=Dianthus caryophyllus GN=GST2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P42760|GSTF6_ARATH Glutathione S-transferase F6 OS=Arabidopsis thaliana GN=GSTF6 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 336 | ||||||
| 91078536 | 379 | PREDICTED: similar to ganglioside-induce | 0.565 | 0.501 | 0.419 | 2e-32 | |
| 332374044 | 365 | unknown [Dendroctonus ponderosae] | 0.547 | 0.504 | 0.391 | 1e-27 | |
| 315633209 | 332 | ganglioside-induced differentiation-asso | 0.532 | 0.539 | 0.392 | 3e-26 | |
| 242003460 | 320 | ganglioside-induced differentiation-asso | 0.5 | 0.525 | 0.353 | 3e-25 | |
| 170047268 | 291 | ganglioside-induced differentiation-asso | 0.529 | 0.611 | 0.338 | 9e-25 | |
| 357628553 | 333 | putative ganglioside-induced differentia | 0.562 | 0.567 | 0.350 | 4e-24 | |
| 157123716 | 316 | hypothetical protein AaeL_AAEL009602 [Ae | 0.550 | 0.585 | 0.331 | 5e-23 | |
| 157111894 | 297 | hypothetical protein AaeL_AAEL015336 [Ae | 0.550 | 0.622 | 0.331 | 8e-23 | |
| 158295400 | 290 | AGAP006132-PA [Anopheles gambiae str. PE | 0.550 | 0.637 | 0.294 | 4e-20 | |
| 195491928 | 327 | GE21484 [Drosophila yakuba] gi|194179876 | 0.550 | 0.565 | 0.333 | 2e-19 |
| >gi|91078536|ref|XP_970577.1| PREDICTED: similar to ganglioside-induced differentiation-associated-protein 1 [Tribolium castaneum] gi|270004029|gb|EFA00477.1| hypothetical protein TcasGA2_TC003336 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 145 bits (367), Expect = 2e-32, Method: Compositional matrix adjust.
Identities = 81/193 (41%), Positives = 118/193 (61%), Gaps = 3/193 (1%)
Query: 1 MTLHEKKLNFKTHLVNLASNEQYESWFLEVNPLGEVPVLVDGVKIIPDSKRIIQYVEDNF 60
M LHEK L F + +VNL NEQY+ W+L +NP GEVPVL D KIIPDS RII Y+EDNF
Sbjct: 89 MALHEKNLAFDSKIVNLIKNEQYQPWYLFLNPRGEVPVLQDTGKIIPDSARIIDYLEDNF 148
Query: 61 SNG-YKRLLPTDMDSKM--DVIALRDEIDSLPVGLITKGAPHHPDFLLNPKSPFLPSNRA 117
SNG RL+P D +++ V R + P G++T GA + L NPKSPF R
Sbjct: 149 SNGDTPRLIPMDQGAEVRQRVTHFRHILQKAPAGMLTTGAMLNQHLLKNPKSPFFAPIRK 208
Query: 118 FMMDNQSRKPQVIRKAADVNPSISDILLDKATRQEQFNKELNNVQNYEQALERVDEVMNR 177
+ + + + +R+ A+ NP +ILL KA+ +E+ K+L++ +N+ L +V +++
Sbjct: 209 ALANAEKNSGKHLREYAEKNPEAKEILLKKASVREEQYKQLSDEKNFRDVLNQVHTILDE 268
Query: 178 IEAILIENNKDNQ 190
IEA L ++ D +
Sbjct: 269 IEAELEKHKGDKE 281
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332374044|gb|AEE62163.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|315633209|ref|NP_001186866.1| ganglioside-induced differentiation-associated-protein [Bombyx mori] gi|315177973|gb|ADT82940.1| ganglioside-induced differentiation-associated-protein [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|242003460|ref|XP_002422741.1| ganglioside-induced differentiation-associated protein 1, 2 gdap, putative [Pediculus humanus corporis] gi|212505574|gb|EEB10003.1| ganglioside-induced differentiation-associated protein 1, 2 gdap, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|170047268|ref|XP_001851150.1| ganglioside-induced differentiation-associated protein 1 [Culex quinquefasciatus] gi|167869731|gb|EDS33114.1| ganglioside-induced differentiation-associated protein 1 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|357628553|gb|EHJ77848.1| putative ganglioside-induced differentiation-associated-protein 1 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|157123716|ref|XP_001653859.1| hypothetical protein AaeL_AAEL009602 [Aedes aegypti] gi|157123718|ref|XP_001653860.1| hypothetical protein AaeL_AAEL009602 [Aedes aegypti] gi|108874280|gb|EAT38505.1| AAEL009602-PA [Aedes aegypti] gi|403183049|gb|EJY57813.1| AAEL009602-PB [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157111894|ref|XP_001657346.1| hypothetical protein AaeL_AAEL015336 [Aedes aegypti] gi|108868317|gb|EAT32542.1| AAEL015336-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|158295400|ref|XP_316195.3| AGAP006132-PA [Anopheles gambiae str. PEST] gi|157016019|gb|EAA10845.3| AGAP006132-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|195491928|ref|XP_002093775.1| GE21484 [Drosophila yakuba] gi|194179876|gb|EDW93487.1| GE21484 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 336 | ||||||
| UNIPROTKB|E1C927 | 330 | GDAP1 "Uncharacterized protein | 0.738 | 0.751 | 0.270 | 1.3e-18 | |
| UNIPROTKB|A6QQZ0 | 358 | GDAP1 "Ganglioside-induced dif | 0.735 | 0.689 | 0.273 | 3.8e-18 | |
| UNIPROTKB|E2R073 | 358 | GDAP1 "Uncharacterized protein | 0.735 | 0.689 | 0.273 | 3.8e-18 | |
| UNIPROTKB|Q8TB36 | 358 | GDAP1 "Ganglioside-induced dif | 0.735 | 0.689 | 0.269 | 5.2e-18 | |
| UNIPROTKB|F1RWK1 | 358 | GDAP1 "Uncharacterized protein | 0.735 | 0.689 | 0.273 | 7.1e-18 | |
| MGI|MGI:1338002 | 358 | Gdap1 "ganglioside-induced dif | 0.738 | 0.692 | 0.267 | 1e-17 | |
| RGD|1309005 | 358 | Gdap1 "ganglioside-induced dif | 0.738 | 0.692 | 0.263 | 1e-17 | |
| ZFIN|ZDB-GENE-050522-424 | 372 | gdap1 "ganglioside-induced dif | 0.732 | 0.661 | 0.249 | 3.6e-13 | |
| MGI|MGI:2385163 | 370 | Gdap1l1 "ganglioside-induced d | 0.562 | 0.510 | 0.260 | 4.8e-08 | |
| TAIR|locus:2025162 | 213 | DHAR2 "AT1G75270" [Arabidopsis | 0.166 | 0.262 | 0.442 | 2.9e-06 |
| UNIPROTKB|E1C927 GDAP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 233 (87.1 bits), Expect = 1.3e-18, P = 1.3e-18
Identities = 71/262 (27%), Positives = 129/262 (49%)
Query: 1 MTLHEKKLNFKTHLVNLASNEQYESWFLEVNPLGEVPVLVDGVKIIPDSKRIIQYVEDNF 60
+ + EK L + H VNL +E E WF+ +N GEVPVL+ G II ++ +II Y+E F
Sbjct: 27 LAIAEKALTCEEHDVNLPLSEHNEPWFMRLNASGEVPVLIHGENIICEATQIIDYLEATF 86
Query: 61 SNG-YKRLLPTDMDSKMDVIA-LRDEIDSLPVGLITKGAPHHPDFLLNPKSPFLPSNRAF 118
+ RL+P + + R+ +DSLP+ T G HP+ ++ P ++R
Sbjct: 87 VDAEVPRLMPEEGSMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATSR-- 144
Query: 119 MMDNQSRKPQVIRKAADVNPSISDILLDKATRQEQFNKELNNVQNYEQALERVDEVMNRI 178
+ S ++K A+ NP + D + K R + + +N++ ++ L+ +++V++++
Sbjct: 145 IRSQISNTESELKKLAEENPDLQDAYIAKQKRLKSKLLDHDNIKYLKKILDELEKVLDQV 204
Query: 179 EAILIENNKDN--QSRKPQVIRK---AADVNPSISDI---LLDKATRQEQFNKELNNVQN 230
E L N++ +P + + ADV+ +++ L A R K N
Sbjct: 205 ETELQRRNEETPEDGSQPWLCGEFFSLADVSLAVTLHRLKFLGLARRNWGNGKRPNLEAY 264
Query: 231 YEQALER--VDEVMNRIEAILI 250
YE+ L+R +V+ + ILI
Sbjct: 265 YERVLKRKAFHKVLGHVNNILI 286
|
|
| UNIPROTKB|A6QQZ0 GDAP1 "Ganglioside-induced differentiation-associated protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R073 GDAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8TB36 GDAP1 "Ganglioside-induced differentiation-associated protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RWK1 GDAP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1338002 Gdap1 "ganglioside-induced differentiation-associated-protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1309005 Gdap1 "ganglioside-induced differentiation-associated-protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050522-424 gdap1 "ganglioside-induced differentiation-associated protein 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2385163 Gdap1l1 "ganglioside-induced differentiation-associated protein 1-like 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025162 DHAR2 "AT1G75270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 4th Layer | 2.5.1.18 | LOW CONFIDENCE prediction! |
| 3rd Layer | 2.5.1 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 336 | |||
| cd00570 | 71 | cd00570, GST_N_family, Glutathione S-transferase ( | 2e-11 | |
| cd03052 | 73 | cd03052, GST_N_GDAP1, GST_N family, Ganglioside-in | 3e-10 | |
| COG0625 | 211 | COG0625, Gst, Glutathione S-transferase [Posttrans | 2e-09 | |
| cd03042 | 73 | cd03042, GST_N_Zeta, GST_N family, Class Zeta subf | 2e-09 | |
| pfam13409 | 68 | pfam13409, GST_N_2, Glutathione S-transferase, N-t | 3e-09 | |
| pfam13417 | 75 | pfam13417, GST_N_3, Glutathione S-transferase, N-t | 6e-09 | |
| cd03053 | 76 | cd03053, GST_N_Phi, GST_N family, Class Phi subfam | 1e-08 | |
| TIGR01262 | 210 | TIGR01262, maiA, maleylacetoacetate isomerase | 2e-08 | |
| cd03048 | 81 | cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik | 9e-08 | |
| PRK15113 | 214 | PRK15113, PRK15113, glutathione S-transferase; Pro | 3e-07 | |
| cd03046 | 76 | cd03046, GST_N_GTT1_like, GST_N family, Saccharomy | 3e-07 | |
| cd03056 | 73 | cd03056, GST_N_4, GST_N family, unknown subfamily | 5e-07 | |
| cd03051 | 74 | cd03051, GST_N_GTT2_like, GST_N family, Saccharomy | 6e-07 | |
| cd03050 | 76 | cd03050, GST_N_Theta, GST_N family, Class Theta su | 2e-06 | |
| cd03057 | 77 | cd03057, GST_N_Beta, GST_N family, Class Beta subf | 3e-06 | |
| pfam02798 | 74 | pfam02798, GST_N, Glutathione S-transferase, N-ter | 5e-06 | |
| PLN02378 | 213 | PLN02378, PLN02378, glutathione S-transferase DHAR | 5e-06 | |
| PLN02395 | 215 | PLN02395, PLN02395, glutathione S-transferase | 1e-05 | |
| PLN02817 | 265 | PLN02817, PLN02817, glutathione dehydrogenase (asc | 2e-05 | |
| cd03045 | 74 | cd03045, GST_N_Delta_Epsilon, GST_N family, Class | 1e-04 | |
| cd03059 | 73 | cd03059, GST_N_SspA, GST_N family, Stringent starv | 0.002 | |
| pfam06008 | 263 | pfam06008, Laminin_I, Laminin Domain I | 0.002 | |
| cd03043 | 73 | cd03043, GST_N_1, GST_N family, unknown subfamily | 0.003 |
| >gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
Score = 58.7 bits (143), Expect = 2e-11
Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 2/57 (3%)
Query: 1 MTLHEKKLNFKTHLVNLASNEQYESWFLEVNPLGEVPVLVDGVKIIPDSKRIIQYVE 57
+ L EK L ++ V+L EQ E FL +NPLG+VPVL DG ++ +S I++Y+
Sbjct: 17 LALEEKGLPYELVPVDLGEGEQEE--FLALNPLGKVPVLEDGGLVLTESLAILEYLA 71
|
In addition, GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. This family, also referred to as soluble GSTs, is the largest family of GSH transferases and is only distantly related to the mitochondrial GSTs (GSTK subfamily, a member of the DsbA family). Soluble GSTs bear no structural similarity to microsomal GSTs (MAPEG family) and display additional activities unique to their group, such as catalyzing thiolysis, reduction and isomerization of certain compounds. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. Based on sequence similarity, different classes of GSTs have been identified, which display varying tissue distribution, substrate specificities and additional specific activities. In humans, GSTs display polymorphisms which may influence individual susceptibility to diseases such as cancer, arthritis, allergy and sclerosis. Some GST family members with non-GST functions include glutaredoxin 2, the CLIC subfamily of anion channels, prion protein Ure2p, crystallins, metaxin 2 and stringent starvation protein A. Length = 71 |
| >gnl|CDD|239350 cd03052, GST_N_GDAP1, GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >gnl|CDD|239355 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|166019 PLN02378, PLN02378, glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase | Back alignment and domain information |
|---|
| >gnl|CDD|166458 PLN02817, PLN02817, glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >gnl|CDD|239343 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239357 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >gnl|CDD|218852 pfam06008, Laminin_I, Laminin Domain I | Back alignment and domain information |
|---|
| >gnl|CDD|239341 cd03043, GST_N_1, GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 336 | |||
| KOG4420|consensus | 325 | 99.96 | ||
| PLN02395 | 215 | glutathione S-transferase | 99.94 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 99.94 | |
| PLN02473 | 214 | glutathione S-transferase | 99.94 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 99.94 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 99.94 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 99.93 | |
| KOG0868|consensus | 217 | 99.93 | ||
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 99.92 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 99.91 | |
| KOG0406|consensus | 231 | 99.91 | ||
| PRK11752 | 264 | putative S-transferase; Provisional | 99.9 | |
| KOG0867|consensus | 226 | 99.9 | ||
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 99.89 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 99.89 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 99.88 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 99.88 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 99.85 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 99.81 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 99.77 | |
| KOG1695|consensus | 206 | 99.73 | ||
| PLN02907 | 722 | glutamate-tRNA ligase | 99.66 | |
| KOG1422|consensus | 221 | 99.53 | ||
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 99.49 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 99.45 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 99.43 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 99.43 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 99.41 | |
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 99.41 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 99.4 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 99.38 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 99.33 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 99.33 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 99.31 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 99.3 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 99.3 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 99.29 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 99.28 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 99.28 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 99.27 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 99.26 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 99.24 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 99.24 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 99.23 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 99.22 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 99.22 | |
| cd03204 | 111 | GST_C_GDAP1 GST_C family, Ganglioside-induced diff | 99.17 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 99.17 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 99.17 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 99.12 | |
| KOG4244|consensus | 281 | 99.06 | ||
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 99.05 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 99.02 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 99.01 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 98.94 | |
| cd03196 | 115 | GST_C_5 GST_C family, unknown subfamily 5; compose | 98.9 | |
| cd03198 | 134 | GST_C_CLIC GST_C family, Chloride Intracellular Ch | 98.89 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 98.86 | |
| cd03201 | 121 | GST_C_DHAR GST_C family, Dehydroascorbate Reductas | 98.85 | |
| cd03207 | 103 | GST_C_8 GST_C family, unknown subfamily 8; compose | 98.81 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 98.81 | |
| cd03183 | 126 | GST_C_Theta GST_C family, Class Theta subfamily; c | 98.81 | |
| cd03186 | 107 | GST_C_SspA GST_N family, Stringent starvation prot | 98.8 | |
| cd03188 | 114 | GST_C_Beta GST_C family, Class Beta subfamily; GST | 98.79 | |
| cd03187 | 118 | GST_C_Phi GST_C family, Class Phi subfamily; compo | 98.78 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 98.78 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 98.78 | |
| PF13410 | 69 | GST_C_2: Glutathione S-transferase, C-terminal dom | 98.77 | |
| PF00043 | 95 | GST_C: Glutathione S-transferase, C-terminal domai | 98.77 | |
| cd03210 | 126 | GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar | 98.76 | |
| cd03189 | 119 | GST_C_GTT1_like GST_C family, Saccharomyces cerevi | 98.75 | |
| cd03190 | 142 | GST_C_ECM4_like GST_C family, ECM4-like subfamily; | 98.73 | |
| cd03185 | 126 | GST_C_Tau GST_C family, Class Tau subfamily; GSTs | 98.72 | |
| cd03209 | 121 | GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar | 98.7 | |
| cd03184 | 124 | GST_C_Omega GST_C family, Class Omega subfamily; G | 98.7 | |
| cd03178 | 113 | GST_C_Ure2p_like GST_C family, Ure2p-like subfamil | 98.7 | |
| KOG3029|consensus | 370 | 98.69 | ||
| cd03191 | 121 | GST_C_Zeta GST_C family, Class Zeta subfamily; GST | 98.68 | |
| cd03180 | 110 | GST_C_2 GST_C family, unknown subfamily 2; compose | 98.67 | |
| cd03208 | 137 | GST_C_Alpha GST_C family, Class Alpha subfamily; G | 98.66 | |
| cd03177 | 118 | GST_C_Delta_Epsilon GST_C family, Class Delta and | 98.63 | |
| cd03200 | 96 | GST_C_JTV1 GST_C family, JTV-1 subfamily; composed | 98.63 | |
| PF14497 | 99 | GST_C_3: Glutathione S-transferase, C-terminal dom | 98.62 | |
| cd03182 | 117 | GST_C_GTT2_like GST_C family, Saccharomyces cerevi | 98.59 | |
| COG0435 | 324 | ECM4 Predicted glutathione S-transferase [Posttran | 98.58 | |
| cd03206 | 100 | GST_C_7 GST_C family, unknown subfamily 7; compose | 98.57 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 98.56 | |
| cd03194 | 114 | GST_C_3 GST_C family, unknown subfamily 3; compose | 98.56 | |
| cd03181 | 123 | GST_C_EFB1gamma GST_C family, Gamma subunit of Elo | 98.56 | |
| cd03203 | 120 | GST_C_Lambda GST_C family, Class Lambda subfamily; | 98.5 | |
| cd03195 | 114 | GST_C_4 GST_C family, unknown subfamily 4; compose | 98.49 | |
| KOG2903|consensus | 319 | 98.48 | ||
| cd03202 | 124 | GST_C_etherase_LigE GST_C family, Beta etherase Li | 98.42 | |
| KOG3027|consensus | 257 | 98.41 | ||
| cd03179 | 105 | GST_C_1 GST_C family, unknown subfamily 1; compose | 98.35 | |
| cd03193 | 88 | GST_C_Metaxin GST_C family, Metaxin subfamily; com | 98.35 | |
| cd00299 | 100 | GST_C_family Glutathione S-transferase (GST) famil | 98.18 | |
| cd03192 | 104 | GST_C_Sigma_like GST_C family, Class Sigma_like; c | 98.09 | |
| cd03205 | 98 | GST_C_6 GST_C family, unknown subfamily 6; compose | 97.97 | |
| cd03211 | 126 | GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me | 97.96 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 97.89 | |
| cd03212 | 137 | GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, | 97.87 | |
| cd03197 | 149 | GST_C_mPGES2 GST_C family; microsomal Prostaglandi | 97.7 | |
| PF14834 | 117 | GST_C_4: Glutathione S-transferase, C-terminal dom | 97.51 | |
| KOG3028|consensus | 313 | 97.27 | ||
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 96.99 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 96.13 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 96.0 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 95.89 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 95.2 | |
| cd03199 | 128 | GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub | 94.95 | |
| PF04399 | 132 | Glutaredoxin2_C: Glutaredoxin 2, C terminal domain | 94.83 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 94.77 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 94.63 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 93.89 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 93.24 | |
| KOG1147|consensus | 712 | 92.8 | ||
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 92.29 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 92.16 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 91.45 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 90.99 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 90.4 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 89.05 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 87.48 | |
| PF11287 | 112 | DUF3088: Protein of unknown function (DUF3088); In | 86.0 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 85.06 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 85.01 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 83.21 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 82.1 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 81.62 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 80.58 |
| >KOG4420|consensus | Back alignment and domain information |
|---|
Probab=99.96 E-value=9.3e-28 Score=211.89 Aligned_cols=237 Identities=23% Similarity=0.392 Sum_probs=198.9
Q ss_pred CcccccCCCcEEEEeeCCCCCCCchhhHhhCCCCCcceEEeCCeecccHHHHHHHHHHhCCCCCCCCCCCC-hhhHHHHH
Q psy17289 1 MTLHEKKLNFKTHLVNLASNEQYESWFLEVNPLGEVPVLVDGVKIIPDSKRIIQYVEDNFSNGYKRLLPTD-MDSKMDVI 79 (336)
Q Consensus 1 l~L~~kgI~ye~~~vd~~~~e~~~~e~l~~nP~gkVPvL~ddg~~l~ES~aIl~YL~~~~~~~~~~L~P~~-~~era~v~ 79 (336)
|+++||||+|+...|++..++++++||+.+||.|+||||++|+.+|.||+-|++|++++|-+. ..|.|.- .....++.
T Consensus 43 lvi~EK~id~~~y~V~l~~geh~epwFmrlNp~gevPVl~~g~~II~d~tqIIdYvErtf~ge-r~l~pe~~S~~~d~~l 121 (325)
T KOG4420|consen 43 LVIAEKGIDCEEYDVSLPQGEHKEPWFMRLNPGGEVPVLIHGDNIISDYTQIIDYVERTFTGE-RVLMPEVGSLQHDRVL 121 (325)
T ss_pred eehhhcccccceeeccCccccccCchheecCCCCCCceEecCCeecccHHHHHHHHHHhhccc-ccccccccccccHHHH
Confidence 578999999999999999999999999999999999999999999999999999999999876 5688864 33456788
Q ss_pred HHHHHhhcccccccccCCCCCCccccCCCCCCCccchhhhccccCChhHHHHHhhcCCCchhHHHHHHHHHHHHHHHhhc
Q psy17289 80 ALRDEIDSLPVGLITKGAPHHPDFLLNPKSPFLPSNRAFMMDNQSRKPQVIRKAADVNPSISDILLDKATRQEQFNKELN 159 (336)
Q Consensus 80 ~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~R~~~~~~~~~~~~~l~~~~~~~p~~~~~~~~k~~~~~~~~~~~~ 159 (336)
.+++.++.+....+..||.+||......+.|++++.|......... +..-...+.|+..+++.+++++.+.+..-..
T Consensus 122 ~~e~~l~~lpm~~~t~g~~lh~eL~~~s~iP~~~~iR~~~~k~~~~---v~~l~~~e~pdla~ay~akqkkl~~kl~~hd 198 (325)
T KOG4420|consen 122 QYEELLDALPMDAYTHGCILHPELTTDSMIPKYAEIRRHLAKATTD---VMKLDHEEEPDLAEAYLAKQKKLMAKLLEHD 198 (325)
T ss_pred HHHHHHHhcCcchhhccccccchhhccccCcccHHHHHHHHHHHHH---HHHHHhhcCchhhHHHHHHHHHHHHHHHhcc
Confidence 8888999999999999999999999999899998877664433322 2222334558999999999998888888888
Q ss_pred ChhhHHHHHHHHHHHHHHHHHHHhhcCCCCCCCCcCccceecCCCCCHhHhhhHHHhhHH-------Hh--cccCchHHH
Q psy17289 160 NVQNYEQALERVDEVMNRIEAILIENNKDNQSRKPQVIRKAADVNPSISDILLDKATRQE-------QF--NKELNNVQN 230 (336)
Q Consensus 160 ~~~~~~~~~~~l~~~L~~LE~~L~~~~~g~~~~~~~~~~fL~Gd~~T~ADi~l~~~l~~~-------~~--~~~~p~L~~ 230 (336)
+....++.+..+..+|+++|+-|++++. |.+||+|+.+|+||++|.+.+... ++ ....|+|..
T Consensus 199 d~s~lkkild~l~~~Ld~VEteLe~r~~--------~~~wL~G~efslADVsLg~~LhRL~~Lg~e~~yw~~gsrpnle~ 270 (325)
T KOG4420|consen 199 DVSYLKKILDELAMVLDQVETELEKRKL--------CELWLCGCEFSLADVSLGATLHRLKFLGLEKKYWEDGSRPNLES 270 (325)
T ss_pred cHHHHHHHHHHHHHHHHHHHHHHhhccc--------cceeeccccchHHHHHHHHHHHHHHHcccHHHhcccCCCccHHH
Confidence 8889999999999999999999986522 448999999999999999876432 22 247899999
Q ss_pred HHHHHHhHHHHHHHHHHHH
Q psy17289 231 YEQALERVDEVMNRIEAIL 249 (336)
Q Consensus 231 w~~~~~~~~~~~~~i~a~~ 249 (336)
|+.|+++|+++.+.+....
T Consensus 271 Yf~rvrrR~sf~kvlg~~f 289 (325)
T KOG4420|consen 271 YFERVRRRFSFRKVLGDIF 289 (325)
T ss_pred HHHHHHhhhHHHHhhhhHH
Confidence 9999999999988765443
|
|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0868|consensus | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0406|consensus | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0867|consensus | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >KOG1695|consensus | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >KOG1422|consensus | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >KOG4244|consensus | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant | Back alignment and domain information |
|---|
| >cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B | Back alignment and domain information |
|---|
| >PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 | Back alignment and domain information |
|---|
| >cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >KOG3029|consensus | Back alignment and domain information |
|---|
| >cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene | Back alignment and domain information |
|---|
| >PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B | Back alignment and domain information |
|---|
| >cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs | Back alignment and domain information |
|---|
| >cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >KOG2903|consensus | Back alignment and domain information |
|---|
| >cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >KOG3027|consensus | Back alignment and domain information |
|---|
| >cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha | Back alignment and domain information |
|---|
| >cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins | Back alignment and domain information |
|---|
| >cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A | Back alignment and domain information |
|---|
| >KOG3028|consensus | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1147|consensus | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 336 | ||||
| 1e6b_A | 221 | Crystal Structure Of A Zeta Class Glutathione S-Tra | 1e-06 | ||
| 1aw9_A | 216 | Structure Of Glutathione S-Transferase Iii In Apo F | 3e-06 | ||
| 1gnw_A | 211 | Structure Of Glutathione S-Transferase Length = 211 | 4e-06 | ||
| 3qav_A | 243 | Crystal Structure Of A Glutathione S-transferase Fr | 1e-04 | ||
| 4ivf_A | 231 | Crystal Structure Of Glutathione Transferase Homolo | 6e-04 |
| >pdb|1E6B|A Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana Length = 221 | Back alignment and structure |
|
| >pdb|1AW9|A Chain A, Structure Of Glutathione S-Transferase Iii In Apo Form Length = 216 | Back alignment and structure |
| >pdb|1GNW|A Chain A, Structure Of Glutathione S-Transferase Length = 211 | Back alignment and structure |
| >pdb|3QAV|A Chain A, Crystal Structure Of A Glutathione S-transferase From Antarctic Clam Laternula Elliptica Length = 243 | Back alignment and structure |
| >pdb|4IVF|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Lodderomyces Elongisporus, Target Efi-501753, With Two Gsh Per Subunit Length = 231 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 | Back alignment and structure |
|---|
Score = 75.8 bits (187), Expect = 2e-16
Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
Query: 1 MTLHEKKLNFKTHLVNLASNEQYESWFLEVNPLGEVPVLVDGVKIIPDSKRIIQYVEDNF 60
+ L+ K + ++ V+L E + F +NP VP L G +++ S II+++E+ +
Sbjct: 19 IALNLKGVPYEYLAVHLGKEEHLKDAFKALNPQQLVPALDTGAQVLIQSPAIIEWLEEQY 78
Query: 61 SNGYKRLLPTD 71
LLP D
Sbjct: 79 --PTPALLPAD 87
|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 | Back alignment and structure |
|---|
| >4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Length = 244 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 336 | |||
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 99.96 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 99.96 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 99.95 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 99.95 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 99.95 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 99.95 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 99.94 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 99.94 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 99.94 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 99.94 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 99.94 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 99.94 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 99.93 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 99.93 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 99.93 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 99.93 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 99.93 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 99.93 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 99.93 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 99.93 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 99.93 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 99.93 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 99.93 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 99.93 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 99.93 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 99.93 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 99.93 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 99.93 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 99.93 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 99.93 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 99.93 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 99.93 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 99.93 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 99.93 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 99.93 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 99.93 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 99.93 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 99.93 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 99.93 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 99.92 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 99.92 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 99.92 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 99.92 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 99.92 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 99.92 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 99.92 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 99.92 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 99.92 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 99.92 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 99.92 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 99.92 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 99.92 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 99.92 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 99.92 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 99.92 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 99.92 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 99.92 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 99.92 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 99.91 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 99.91 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 99.91 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 99.91 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 99.91 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 99.91 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 99.91 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 99.91 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 99.91 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 99.91 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 99.91 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 99.91 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 99.91 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 99.91 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 99.91 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 99.91 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 99.91 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 99.91 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 99.91 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 99.9 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 99.9 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 99.9 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 99.9 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 99.9 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 99.9 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 99.9 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 99.89 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 99.89 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 99.89 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 99.89 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 99.89 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 99.89 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 99.89 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 99.89 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 99.89 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 99.88 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 99.88 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 99.88 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.88 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 99.88 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 99.87 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.87 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 99.86 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 99.85 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 99.84 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 99.83 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 99.83 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 99.82 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 99.82 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 99.81 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.79 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 99.7 | |
| 4fqu_A | 313 | Putative glutathione transferase; glutathionyl-hyd | 99.69 | |
| 4g0i_A | 328 | Protein YQJG; glutathionyl-hydroquinone reductase, | 99.68 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 99.58 | |
| 2hsn_A | 160 | Methionyl-tRNA synthetase, cytoplasmic; protein co | 99.54 | |
| 2hqt_A | 124 | GU4 nucleic-binding protein 1; GST-fold, biosynthe | 98.28 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 97.46 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 97.44 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 96.77 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 96.59 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 95.65 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 94.11 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 94.07 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 92.98 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 92.77 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 90.6 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 90.24 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 90.03 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 87.97 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 87.01 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 86.9 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 86.1 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 85.3 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 85.16 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 84.56 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 84.16 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 83.86 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 83.16 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 81.27 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 80.12 |
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
Probab=99.96 E-value=3.4e-28 Score=215.96 Aligned_cols=179 Identities=22% Similarity=0.251 Sum_probs=135.8
Q ss_pred CcccccCCCcEEEEeeCCCCCCCchhhHhhCCCCCcceEEeCCeecccHHHHHHHHHHhCCCCCCCCCCCChhhHHHHHH
Q psy17289 1 MTLHEKKLNFKTHLVNLASNEQYESWFLEVNPLGEVPVLVDGVKIIPDSKRIIQYVEDNFSNGYKRLLPTDMDSKMDVIA 80 (336)
Q Consensus 1 l~L~~kgI~ye~~~vd~~~~e~~~~e~l~~nP~gkVPvL~ddg~~l~ES~aIl~YL~~~~~~~~~~L~P~~~~era~v~~ 80 (336)
|+|+++||+|+.+.|++..+++.+++|+++||.|+||+|+|||.+|+||.+|++||+++|+.. +.|+|.++.+++.+++
T Consensus 19 ~~l~~~gi~~e~~~v~~~~~~~~~~~~~~~nP~g~vP~L~d~g~~l~eS~aI~~YL~~~~~~~-~~l~p~~~~~~~~~~~ 97 (216)
T 3vk9_A 19 LTAKALNLNLNLKLVDLHHGEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLVNKYAKG-SSLYPEDPKARALVDQ 97 (216)
T ss_dssp HHHHHHTCCCEEEECCGGGTGGGSHHHHHHCTTCCSCEEEETTEEECCHHHHHHHHHHHHCTT-CTTSCCSHHHHHHHHH
T ss_pred HHHHHcCCCCEEEEeCCCCCccCCHHHHHhCCCCccceEecCCceeechHHHHHHHHHhcCcc-cCCCCCCHHHHHHhhh
Confidence 468999999999999999999999999999999999999999999999999999999999864 5789999999999988
Q ss_pred HHHHhhcccccccccCCCCCCccccCCCCCCCccchhhhccccCChhHHHHHhhcCCCchhHHHHHHHHHHHHHHHhhcC
Q psy17289 81 LRDEIDSLPVGLITKGAPHHPDFLLNPKSPFLPSNRAFMMDNQSRKPQVIRKAADVNPSISDILLDKATRQEQFNKELNN 160 (336)
Q Consensus 81 ~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~R~~~~~~~~~~~~~l~~~~~~~p~~~~~~~~k~~~~~~~~~~~~~ 160 (336)
|..+.... +.+.+. ..+.. .....
T Consensus 98 ~l~~~~~~----------~~~~~~-----------------------~~~~~-----------------------~~~~~ 121 (216)
T 3vk9_A 98 RLYFDIGT----------LYQRFS-----------------------DYFYP-----------------------QVFAG 121 (216)
T ss_dssp HHHHHHHT----------HHHHHH-----------------------HHHHH-----------------------HHHSC
T ss_pred hHHHHhhh----------hhhHHH-----------------------HHHHH-----------------------HHHhc
Confidence 87533211 110000 00000 00001
Q ss_pred hhhHHHHHHHHHHHHHHHHHHHhhcCCCCCCCCcCccceecCCCCCHhHhhhHHHhhHH-Hh---cccCchHHHHHHHHH
Q psy17289 161 VQNYEQALERVDEVMNRIEAILIENNKDNQSRKPQVIRKAADVNPSISDILLDKATRQE-QF---NKELNNVQNYEQALE 236 (336)
Q Consensus 161 ~~~~~~~~~~l~~~L~~LE~~L~~~~~g~~~~~~~~~~fL~Gd~~T~ADi~l~~~l~~~-~~---~~~~p~L~~w~~~~~ 236 (336)
....+...+.+.+.|+.+|++|++ + +||+|+++|+|||++++.+... .. ..++|+|.+|++++.
T Consensus 122 ~~~~~~~~~~~~~~l~~le~~L~~----~--------~~l~G~~~t~ADi~~~~~l~~~~~~~~~~~~~P~l~~w~~r~~ 189 (216)
T 3vk9_A 122 APADKAKNEKVQEALQLLDKFLEG----Q--------KYVAGPNLTVADLSLIASVSSLEASDIDFKKYANVKRWYETVK 189 (216)
T ss_dssp CCCCHHHHHHHHHHHHHHHHHTTT----C--------SBTTBSSCCHHHHHHHHHHHHGGGTTCCGGGSHHHHHHHHHHH
T ss_pred chhHHHHHHHHHHHHHHHHHHhcc----C--------CCCCCCCCCHHHHHHHHHHHHHHHcCCCchhCHHHHHHHHHHH
Confidence 111123345778889999999964 3 6999999999999999876543 22 257899999999998
Q ss_pred hH-HHHHHHHHHH
Q psy17289 237 RV-DEVMNRIEAI 248 (336)
Q Consensus 237 ~~-~~~~~~i~a~ 248 (336)
++ |+++++++..
T Consensus 190 a~~P~~~~a~~~g 202 (216)
T 3vk9_A 190 STAPGYQEANEKG 202 (216)
T ss_dssp HHSTTHHHHTHHH
T ss_pred ccCHHHHHHHHHH
Confidence 87 8998876543
|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} | Back alignment and structure |
|---|
| >4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A | Back alignment and structure |
|---|
| >2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 336 | ||||
| d1r5aa2 | 85 | c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph | 6e-12 | |
| d1jlva2 | 84 | c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph | 2e-11 | |
| d1axda2 | 80 | c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), | 4e-10 | |
| d1e6ba2 | 80 | c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress | 3e-09 | |
| d1fw1a2 | 83 | c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi | 7e-09 | |
| d1aw9a2 | 81 | c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), | 2e-08 | |
| d1gnwa2 | 84 | c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( | 2e-08 | |
| d2c4ja2 | 84 | c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien | 2e-07 | |
| d1f2ea2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau | 4e-07 | |
| d1v2aa2 | 83 | c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph | 6e-07 | |
| d1ljra2 | 79 | c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap | 1e-06 | |
| d1n2aa2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Escherichia coli | 4e-06 | |
| d1k0ma2 | 86 | c.47.1.5 (A:6-91) Chloride intracellular channel 1 | 5e-06 | |
| d1pmta2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili | 6e-06 | |
| d1gula2 | 77 | c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap | 2e-05 | |
| d1nhya2 | 75 | c.47.1.5 (A:1-75) GST-like domain of elongation fa | 4e-05 | |
| d2a2ra2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien | 7e-05 | |
| d1oyja2 | 84 | c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ | 8e-05 | |
| d1k3ya2 | 79 | c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap | 1e-04 | |
| d1b48a2 | 78 | c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc | 1e-04 | |
| d1g7oa2 | 75 | c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli | 4e-04 | |
| d1k0da2 | 92 | c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni | 5e-04 | |
| d1eema2 | 98 | c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa | 5e-04 | |
| d2fnoa2 | 87 | c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752 | 6e-04 | |
| d1fhea2 | 80 | c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati | 0.001 | |
| d1gwca2 | 83 | c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii | 0.002 |
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Glutathione S-transferase (GST), N-terminal domain domain: Class delta GST species: Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]
Score = 58.8 bits (142), Expect = 6e-12
Identities = 14/69 (20%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
Query: 1 MTLHEKKLNFKTHLVNLASNEQYESWFLEVNPLGEVPVLVDGVKIIPDSKRIIQYVEDNF 60
+ + ++N+ EQ + F+E+NP +P + D ++ +S+ I+ Y+ +
Sbjct: 18 LLAKMIGVELDLKVLNIMEGEQLKPDFVELNPQHCIPTMDDHGLVLWESRVILSYLVSAY 77
Query: 61 SNGYKRLLP 69
+ L P
Sbjct: 78 GKD-ENLYP 85
|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 336 | |||
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.69 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.68 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.68 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.64 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.63 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.61 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.6 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.59 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.58 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.58 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.56 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.56 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 99.53 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.48 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 99.47 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.47 | |
| d1aw9a1 | 135 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.38 | |
| d1axda1 | 129 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.37 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.37 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.35 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.34 | |
| d1f2ea1 | 121 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.34 | |
| d1e6ba1 | 133 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.33 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1pmta1 | 121 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.32 | |
| d1fw1a1 | 125 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.31 | |
| d1n2aa1 | 121 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.31 | |
| d1eema1 | 139 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.31 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.3 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.3 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.29 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.28 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.27 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 99.27 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.27 | |
| d2gsqa1 | 127 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.26 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 99.25 | |
| d1nhya1 | 144 | GST-like domain of elongation factor 1-gamma {Bake | 99.24 | |
| d2cvda1 | 124 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.24 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.23 | |
| d1gwca1 | 138 | Class tau GST {Aegilops tauschii, also known as Tr | 99.23 | |
| d1ljra1 | 165 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.23 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.22 | |
| d1k3ya1 | 142 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.2 | |
| d1gnwa1 | 126 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.2 | |
| d1b48a1 | 143 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.2 | |
| d1k0da1 | 151 | Yeast prion protein ure2p, nitrogen regulation fra | 99.19 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 99.19 | |
| d1v2aa1 | 125 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.18 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 99.18 | |
| d3gtub1 | 140 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d1m0ua1 | 127 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.16 | |
| d1tw9a1 | 129 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.15 | |
| d1jlwa1 | 127 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.14 | |
| d1jlva1 | 123 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.13 | |
| d1gula1 | 140 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.11 | |
| d2a2ra1 | 132 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.11 | |
| d2c4ja1 | 133 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.09 | |
| d2gsta1 | 133 | Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 | 99.07 | |
| d1gsua1 | 133 | Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 | 99.05 | |
| d1r5aa1 | 129 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.02 | |
| d1okta1 | 126 | Pf GST {Malarial parasite (Plasmodium falciparum) | 98.99 | |
| d1duga1 | 140 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 98.93 | |
| d1oyja1 | 145 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 98.9 | |
| d2fhea1 | 136 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 98.9 | |
| d1oe8a1 | 123 | Class alpha GST {Blood fluke (Schistosoma haematob | 98.88 | |
| d1oe8a2 | 81 | Class alpha GST {Blood fluke (Schistosoma haematob | 98.85 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.82 | |
| d1tu7a1 | 131 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 98.73 | |
| d2hrkb1 | 118 | GU4 nucleic-binding protein 1, Arc1p {Baker's yeas | 98.52 | |
| d1k0ma1 | 149 | Chloride intracellular channel 1 (clic1) {Human (H | 98.47 | |
| d1z9ha1 | 161 | Microsomal prostaglandin E synthase-2 {Crab-eating | 97.64 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 94.6 | |
| d1g7oa1 | 140 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 92.95 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 90.62 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 87.99 | |
| d2fnoa1 | 149 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 86.46 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 86.34 |
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Glutathione S-transferase (GST), N-terminal domain domain: Class delta GST species: Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]
Probab=99.69 E-value=7.4e-18 Score=126.21 Aligned_cols=68 Identities=21% Similarity=0.403 Sum_probs=63.0
Q ss_pred CcccccCCCcEEEEeeCCCCCCCchhhHhhCCCCCcceEEeCCeecccHHHHHHHHHHhCCCCCCCCCC
Q psy17289 1 MTLHEKKLNFKTHLVNLASNEQYESWFLEVNPLGEVPVLVDGVKIIPDSKRIIQYVEDNFSNGYKRLLP 69 (336)
Q Consensus 1 l~L~~kgI~ye~~~vd~~~~e~~~~e~l~~nP~gkVPvL~ddg~~l~ES~aIl~YL~~~~~~~~~~L~P 69 (336)
|+|+++|++|+.+.|++..+++++++|+++||.|+||+|+|||.+|+||.||++||+++|+.+ ..|+|
T Consensus 18 ~~l~e~gi~~e~~~v~~~~~~~~~~~~~~~nP~g~vP~L~~~~~~l~ES~aI~~YL~~~~~~~-~~L~P 85 (85)
T d1r5aa2 18 LLAKMIGVELDLKVLNIMEGEQLKPDFVELNPQHCIPTMDDHGLVLWESRVILSYLVSAYGKD-ENLYP 85 (85)
T ss_dssp HHHHHTTCCEEEEECCTTTTGGGSHHHHTTCTTCCSSEEEETTEEEECHHHHHHHHHHHHCCS-SCSSC
T ss_pred HHHHHcCCCCEEEEecCCCcccCCHHHHHHHhcCCCCEEEEcccceecHHHHHHHHHHHhCCC-CCCCC
Confidence 468999999999999999899999999999999999999999999999999999999999754 46776
|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|