Diaphorina citri psyllid: psy17304


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
IVHKLCGNGVVDEDEDCDCGSIDECHEKDPCCDAITCKLKKESQCADGPCCDNCKLRPFGHICREAKTECDLPEWCTGTSGECPADEFKKNGNPCNMRTGFCFNGFCPTVDVQCEEIWG
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHcc
IVHKLCGNGVVDEDEDCDCGSIDECHEKDPCCDAITCKLKKESQCADGPCCDNCKLRPFGHICREAKTECDLPEWCTGTSGECPADEFKKNGNPCNMRTGFCFNGFCPTVDVQCEEIWG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IVHKLCGNGVVDEDEDCDCGSIDECHEKDPCCDAITCKLKKESQCADGPCCDNCKLRPFGHICREAKTECDLPEWCTGTSGECPADEFKKNGNPCNMRTGFCFNGFCPTVDVQCEEIWG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Disintegrin and metalloproteinase domain-containing protein 28 May play a role in organogenesis and organ-specific functions such as thymic T-cell development.confidentQ9JLN6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044358 [BP]envenomation resulting in hemorrhagic damage to other organismprobableGO:0050896, GO:0007610, GO:0008150, GO:0035737, GO:0035738, GO:0051705, GO:0051704
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0004222 [MF]metalloendopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008237
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0044477 [BP]envenomation resulting in negative regulation of platelet aggregation in other organismprobableGO:0044468, GO:0044483, GO:0044365, GO:0050896, GO:0007610, GO:0044470, GO:0008150, GO:0035737, GO:0035738, GO:0051705, GO:0051704
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0032270 [BP]positive regulation of cellular protein metabolic processprobableGO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031323, GO:0051247, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0044481 [BP]envenomation resulting in proteolysis in other organismprobableGO:0050896, GO:0007610, GO:0008150, GO:0035737, GO:0035738, GO:0051705, GO:0051704
GO:0044485 [BP]envenomation resulting in fibrinogenolysis in other organismprobableGO:0044483, GO:0050896, GO:0007610, GO:0065007, GO:0035737, GO:0035738, GO:0008150, GO:0065008, GO:0044536, GO:0044537, GO:0051705, GO:0051704
GO:0009611 [BP]response to woundingprobableGO:0006950, GO:0008150, GO:0050896
GO:0030195 [BP]negative regulation of blood coagulationprobableGO:0032101, GO:0080134, GO:0051241, GO:0048583, GO:1900046, GO:0050789, GO:0008150, GO:0061041, GO:1900047, GO:0065007, GO:0051239, GO:0030193, GO:0048519, GO:0050818, GO:0050819
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K7L, chain A
Confidence level:very confident
Coverage over the Query: 2-119
View the alignment between query and template
View the model in PyMOL