Diaphorina citri psyllid: psy17308

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MLRDIIPFIRPKLGKLHEASCTDAFIKISRTEGILSLWSGLAPTLLLALPATIAYFVTYEQLRVKLKDLFSPSLHEQPFWIPLISGSVARIGAVTLVSPLELVRTKMQSEKMSYFGKE
ccccccccccccccccccccHHHHHHHHHHHHcHHHHHccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccc
MLRDIIPFIRPKLGKLHEASCTDAFIKISRTEGILSLWSGLAPTLLLALPATIAYFVTYEQLRVKLKDLFSPSLHEQPFWIPLISGSVARIGAVTLVSPLELVRT*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRDIIPFIRPKLGKLHEASCTDAFIKISRTEGILSLWSGLAPTLLLALPATIAYFVTYEQLRVKLKDLFSPSLHEQPFWIPLISGSVARIGAVTLVSPLELVRTKMQSEKMSYFGKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Solute carrier family 25 member 40 confidentQ8TBP6
Solute carrier family 25 member 40 confidentQ0VCH6
Solute carrier family 25 member 39 May be involved in the early steps of heme biosynthesis or in the regulation of delta-aminolevulinic acid synthase function.confidentQ7SXW0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006839 [BP]mitochondrial transportprobableGO:0009987, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0006812 [BP]cation transportprobableGO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 2-111
View the alignment between query and template
View the model in PyMOL