Diaphorina citri psyllid: psy17313

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MICEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAGAGLNPKKKA
cccccHHHHHHHHHccccccccEEEEEEcccccccccccccHHHHHHHHHHcccccEEEEEEHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEcccccccEEEEccccccccccccccccccccccEEEEEEEcHHHHHHcccHHHHHHccccHcccccEEEEcccEEEEEccccccccccccc
**CEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAGA********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MICEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAGAGLNPKKKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Obg-like ATPase 1 Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.confidentA0JPJ7
Obg-like ATPase 1 Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.confidentQ7ZU42
GTP-binding protein CG1354 confidentQ8SWU7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OHF, chain A
Confidence level:very confident
Coverage over the Query: 6-186
View the alignment between query and template
View the model in PyMOL