Psyllid ID: psy17313

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MICEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAGAGLNPKKKA
cccccHHHHHHHHHccccccccEEEEEEcccccccccccccHHHHHHHHHHcccccEEEEEEHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEcccccccEEEEccccccccccccccccccccccEEEEEEEcHHHHHHHccHHHHHHcccHHcccccEEEEcccEEEEEccccccccccccc
cccccHHHHHHHHHHcHHccccEEEEEEEccccccccccHHHHHHHHHHHHcccccEEEEEHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHccHHEEcccccEEEEEEEccccccccccEEEEccccccEEEEEEEEHHHHHHcccHHHHHHccccEEcccEEEEEcccEEEEEEEcccccHHcccc
MICEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKikewvdandpgatiipfsgvfehqlvdmpdderqrYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIqkgtkapqaagrihtdFEKGFIMAEVMHfddfkehgSEAACRAAGKyrqqgraytvedgdIIFFkfnagaglnpkkka
MICEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKgtkapqaagriHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFkfnagaglnpkkka
MICEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIkkknkwlpkikEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAGAGLNPKKKA
**CEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDM*******YLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAGA********
**CEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNA**********
MICEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQ********AGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAGAGLNPKKKA
*ICEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAGAG*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MICEHHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAGAGLNPKKKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query197 2.2.26 [Sep-21-2011]
Q8SWU7397 GTP-binding protein CG135 yes N/A 0.954 0.473 0.755 9e-79
P91917395 Putative GTP-binding prot yes N/A 0.954 0.475 0.723 1e-76
Q7ZWM6396 Obg-like ATPase 1 OS=Xeno N/A N/A 0.908 0.452 0.743 9e-75
Q7ZU42396 Obg-like ATPase 1 OS=Dani yes N/A 0.944 0.469 0.712 2e-72
Q66JG0396 Obg-like ATPase 1 OS=Xeno yes N/A 0.908 0.452 0.726 5e-72
Q5ZM25396 Obg-like ATPase 1 OS=Gall yes N/A 0.944 0.469 0.702 1e-70
A0JPJ7396 Obg-like ATPase 1 OS=Ratt yes N/A 0.908 0.452 0.703 1e-69
Q2HJ33396 Obg-like ATPase 1 OS=Bos yes N/A 0.944 0.469 0.686 4e-69
Q9NTK5396 Obg-like ATPase 1 OS=Homo no N/A 0.944 0.469 0.686 6e-69
Q5R821396 Obg-like ATPase 1 OS=Pong yes N/A 0.944 0.469 0.680 1e-68
>sp|Q8SWU7|Y1354_DROME GTP-binding protein CG1354 OS=Drosophila melanogaster GN=CG1354 PE=1 SV=1 Back     alignment and function desciption
 Score =  292 bits (748), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 142/188 (75%), Positives = 156/188 (82%)

Query: 9   IEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQ 68
           IE LNK   LT+K  IYLVNLS KD+I+KKNKWLPKIKEW+D NDPGA +IPFSG FEHQ
Sbjct: 209 IEALNKYLFLTSKPVIYLVNLSDKDFIRKKNKWLPKIKEWIDKNDPGALLIPFSGAFEHQ 268

Query: 69  LVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQA 128
           L +  + ER+ Y  E K  S+L+KI+  GYK LQL+YFFTAG DEVKAWTIQKGTKAPQA
Sbjct: 269 LTEKDELERKAYETETKCKSMLEKIVVTGYKGLQLEYFFTAGPDEVKAWTIQKGTKAPQA 328

Query: 129 AGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAG 188
           AGRIHTDFEKGFIMAEVMHF+DFK  GSEA  +AAGKYRQQGR YTVEDGDIIFFKFNAG
Sbjct: 329 AGRIHTDFEKGFIMAEVMHFEDFKAEGSEANAKAAGKYRQQGRNYTVEDGDIIFFKFNAG 388

Query: 189 AGLNPKKK 196
           AGL   KK
Sbjct: 389 AGLKDAKK 396

Drosophila melanogaster (taxid: 7227)
>sp|P91917|TG210_CAEEL Putative GTP-binding protein tag-210 OS=Caenorhabditis elegans GN=tag-210 PE=3 SV=1 Back     alignment and function description
>sp|Q7ZWM6|OLA1_XENLA Obg-like ATPase 1 OS=Xenopus laevis GN=ola1 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZU42|OLA1_DANRE Obg-like ATPase 1 OS=Danio rerio GN=ola1 PE=2 SV=1 Back     alignment and function description
>sp|Q66JG0|OLA1_XENTR Obg-like ATPase 1 OS=Xenopus tropicalis GN=ola1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZM25|OLA1_CHICK Obg-like ATPase 1 OS=Gallus gallus GN=OLA1 PE=2 SV=1 Back     alignment and function description
>sp|A0JPJ7|OLA1_RAT Obg-like ATPase 1 OS=Rattus norvegicus GN=Ola1 PE=2 SV=1 Back     alignment and function description
>sp|Q2HJ33|OLA1_BOVIN Obg-like ATPase 1 OS=Bos taurus GN=OLA1 PE=2 SV=1 Back     alignment and function description
>sp|Q9NTK5|OLA1_HUMAN Obg-like ATPase 1 OS=Homo sapiens GN=OLA1 PE=1 SV=2 Back     alignment and function description
>sp|Q5R821|OLA1_PONAB Obg-like ATPase 1 OS=Pongo abelii GN=OLA1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
357613126 2193 GTP binding protein [Danaus plexippus] 0.954 0.085 0.776 4e-82
237874213 397 Obg-like ATPase 1 [Acyrthosiphon pisum] 0.964 0.478 0.774 5e-81
380022453 397 PREDICTED: GTP-binding protein CG1354-li 0.954 0.473 0.776 3e-80
114053313 397 GTP binding protein [Bombyx mori] gi|951 0.954 0.473 0.771 3e-80
350426336 397 PREDICTED: GTP-binding protein CG1354-li 0.954 0.473 0.781 9e-80
340723660 397 PREDICTED: GTP-binding protein CG1354-li 0.954 0.473 0.781 1e-79
389611703 397 GTP-binding protein [Papilio xuthus] 0.954 0.473 0.760 2e-79
334855397 397 GTPase [Helicoverpa armigera] 0.954 0.473 0.765 2e-79
110762023 397 PREDICTED: GTP-binding protein CG1354-li 0.954 0.473 0.771 2e-79
383857463 397 PREDICTED: GTP-binding protein CG1354-li 0.954 0.473 0.776 2e-79
>gi|357613126|gb|EHJ68331.1| GTP binding protein [Danaus plexippus] Back     alignment and taxonomy information
 Score =  309 bits (791), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 146/188 (77%), Positives = 160/188 (85%)

Query: 9    IEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQ 68
            IE LNK   LT+K  +YLVNLS KDYI+KKNKWLPK+KEW+D NDPGA +IPFSG  E +
Sbjct: 2005 IEVLNKYLFLTSKPALYLVNLSEKDYIRKKNKWLPKLKEWIDKNDPGAPLIPFSGALESK 2064

Query: 69   LVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQA 128
            L+DM  DER+++L E   TS LDKII QGYKSLQL+YFFTAG DEVKAWTIQKGTKAPQA
Sbjct: 2065 LLDMEPDEREKFLKENNITSALDKIIVQGYKSLQLEYFFTAGADEVKAWTIQKGTKAPQA 2124

Query: 129  AGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAG 188
            AGRIHTDFEKGFIMAEVMHF DFKE GSE+AC+AAGKYRQQGR Y VEDGDIIFFKFNAG
Sbjct: 2125 AGRIHTDFEKGFIMAEVMHFKDFKEEGSESACKAAGKYRQQGRNYVVEDGDIIFFKFNAG 2184

Query: 189  AGLNPKKK 196
            AGL   KK
Sbjct: 2185 AGLKDAKK 2192

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|237874213|ref|NP_001153863.1| Obg-like ATPase 1 [Acyrthosiphon pisum] gi|239788262|dbj|BAH70819.1| ACYPI52009 [Acyrthosiphon pisum] gi|239788264|dbj|BAH70820.1| ACYPI52009 [Acyrthosiphon pisum] gi|239788266|dbj|BAH70821.1| ACYPI52009 [Acyrthosiphon pisum] gi|239788268|dbj|BAH70822.1| ACYPI52009 [Acyrthosiphon pisum] gi|239788270|dbj|BAH70823.1| ACYPI52009 [Acyrthosiphon pisum] gi|239788272|dbj|BAH70824.1| ACYPI52009 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|380022453|ref|XP_003695060.1| PREDICTED: GTP-binding protein CG1354-like [Apis florea] Back     alignment and taxonomy information
>gi|114053313|ref|NP_001040339.1| GTP binding protein [Bombyx mori] gi|95102558|gb|ABF51217.1| GTP binding protein [Bombyx mori] Back     alignment and taxonomy information
>gi|350426336|ref|XP_003494408.1| PREDICTED: GTP-binding protein CG1354-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340723660|ref|XP_003400207.1| PREDICTED: GTP-binding protein CG1354-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|389611703|dbj|BAM19435.1| GTP-binding protein [Papilio xuthus] Back     alignment and taxonomy information
>gi|334855397|gb|AEH16630.1| GTPase [Helicoverpa armigera] Back     alignment and taxonomy information
>gi|110762023|ref|XP_396711.3| PREDICTED: GTP-binding protein CG1354-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383857463|ref|XP_003704224.1| PREDICTED: GTP-binding protein CG1354-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
FB|FBgn0030151397 CG1354 [Drosophila melanogaste 0.954 0.473 0.702 2.8e-66
WB|WBGene00012344395 ola-1 [Caenorhabditis elegans 0.954 0.475 0.670 2.6e-63
ZFIN|ZDB-GENE-030131-5063396 ola1 "Obg-like ATPase 1" [Dani 0.944 0.469 0.664 1.3e-61
UNIPROTKB|Q5ZM25396 OLA1 "Obg-like ATPase 1" [Gall 0.944 0.469 0.654 5e-60
UNIPROTKB|Q2HJ33396 OLA1 "Obg-like ATPase 1" [Bos 0.944 0.469 0.638 1.9e-58
UNIPROTKB|J3KQ32416 OLA1 "Obg-like ATPase 1" [Homo 0.944 0.447 0.638 1.9e-58
UNIPROTKB|Q9NTK5396 OLA1 "Obg-like ATPase 1" [Homo 0.944 0.469 0.638 1.9e-58
UNIPROTKB|F1S062238 OLA1 "Uncharacterized protein" 0.944 0.781 0.638 1.9e-58
RGD|1307982396 Ola1 "Obg-like ATPase 1" [Ratt 0.903 0.449 0.657 1.9e-58
MGI|MGI:1914309396 Ola1 "Obg-like ATPase 1" [Mus 0.944 0.469 0.632 4e-58
FB|FBgn0030151 CG1354 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 674 (242.3 bits), Expect = 2.8e-66, P = 2.8e-66
 Identities = 132/188 (70%), Positives = 145/188 (77%)

Query:     9 IEHLNKLNLLTAKTQIYLVNLSAKDYIXXXXXXXXXXXEWVDANDPGATIIPFSGVFEHQ 68
             IE LNK   LT+K  IYLVNLS KD+I           EW+D NDPGA +IPFSG FEHQ
Sbjct:   209 IEALNKYLFLTSKPVIYLVNLSDKDFIRKKNKWLPKIKEWIDKNDPGALLIPFSGAFEHQ 268

Query:    69 LVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQA 128
             L +  + ER+ Y  E K  S+L+KI+  GYK LQL+YFFTAG DEVKAWTIQKGTKAPQA
Sbjct:   269 LTEKDELERKAYETETKCKSMLEKIVVTGYKGLQLEYFFTAGPDEVKAWTIQKGTKAPQA 328

Query:   129 AGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAG 188
             AGRIHTDFEKGFIMAEVMHF+DFK  GSEA  +AAGKYRQQGR YTVEDGDIIFFKFNAG
Sbjct:   329 AGRIHTDFEKGFIMAEVMHFEDFKAEGSEANAKAAGKYRQQGRNYTVEDGDIIFFKFNAG 388

Query:   189 AGLNPKKK 196
             AGL   KK
Sbjct:   389 AGLKDAKK 396
GO:0005525 "GTP binding" evidence=ISS
GO:0008150 "biological_process" evidence=ND
WB|WBGene00012344 ola-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5063 ola1 "Obg-like ATPase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM25 OLA1 "Obg-like ATPase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJ33 OLA1 "Obg-like ATPase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3KQ32 OLA1 "Obg-like ATPase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NTK5 OLA1 "Obg-like ATPase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S062 OLA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1307982 Ola1 "Obg-like ATPase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1914309 Ola1 "Obg-like ATPase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZM25OLA1_CHICK3, ., 6, ., 3, ., -0.70210.94410.4696yesN/A
A0JPJ7OLA1_RAT3, ., 6, ., 3, ., -0.70390.90860.4520yesN/A
Q7ZU42OLA1_DANRE3, ., 6, ., 3, ., -0.71270.94410.4696yesN/A
Q8SWU7Y1354_DROMENo assigned EC number0.75530.95430.4735yesN/A
Q5R821OLA1_PONAB3, ., 6, ., 3, ., -0.68080.94410.4696yesN/A
P38219OLA1_YEASTNo assigned EC number0.52170.92380.4619yesN/A
Q9CZ30OLA1_MOUSE3, ., 6, ., 3, ., -0.68080.94410.4696yesN/A
Q66JG0OLA1_XENTR3, ., 6, ., 3, ., -0.72620.90860.4520yesN/A
P91917TG210_CAEELNo assigned EC number0.72340.95430.4759yesN/A
Q2HJ33OLA1_BOVIN3, ., 6, ., 3, ., -0.68610.94410.4696yesN/A
O13998YEI3_SCHPONo assigned EC number0.52270.89340.4489yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
PTZ00258390 PTZ00258, PTZ00258, GTP-binding protein; Provision 1e-97
PRK09601364 PRK09601, PRK09601, GTP-binding protein YchF; Revi 3e-69
COG0012372 COG0012, COG0012, Predicted GTPase, probable trans 3e-61
cd0486783 cd04867, TGS_YchF_C, TGS_YchF_C: This subfamily re 3e-56
pfam0607184 pfam06071, YchF-GTPase_C, Protein of unknown funct 4e-52
TIGR00092368 TIGR00092, TIGR00092, GTP-binding protein YchF 1e-48
cd01900274 cd01900, YchF, YchF GTPase 3e-26
cd0493876 cd04938, TGS_Obg-like, TGS_Obg-like: The C-termina 1e-07
cd0161660 cd01616, TGS, The TGS domain, named after the ThrR 2e-05
>gnl|CDD|240334 PTZ00258, PTZ00258, GTP-binding protein; Provisional Back     alignment and domain information 
 Score =  287 bits (738), Expect = 1e-97
 Identities = 115/181 (63%), Positives = 137/181 (75%), Gaps = 3/181 (1%)

Query: 9   IEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQ 68
           IE LN+  LLTAK  IYLVN+S KD+I++KNKWL KIKEWV     G  IIP+S  FE +
Sbjct: 209 IEILNEYQLLTAKPMIYLVNMSEKDFIRQKNKWLAKIKEWVGEKGGG-PIIPYSAEFEEE 267

Query: 69  LVDMPDDE-RQRYLDEQKAT-SVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAP 126
           L ++  +E R+ YL+E     S+LDKII  GYK L L +FFTAG DEV+ WTIQKGTKAP
Sbjct: 268 LAELGSEEERKEYLEEYGIKQSMLDKIIKTGYKLLNLIHFFTAGPDEVRCWTIQKGTKAP 327

Query: 127 QAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFN 186
           QAAG IH+DFEKGFI AEVM ++DF E GSEAA +A GKYRQ+G+ Y V+DGDIIFFKFN
Sbjct: 328 QAAGVIHSDFEKGFICAEVMKYEDFLELGSEAAVKAEGKYRQEGKDYVVQDGDIIFFKFN 387

Query: 187 A 187
            
Sbjct: 388 V 388

Length = 390
>gnl|CDD|236583 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed Back     alignment and domain information
>gnl|CDD|223091 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133440 cd04867, TGS_YchF_C, TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown Back     alignment and domain information
>gnl|CDD|203386 pfam06071, YchF-GTPase_C, Protein of unknown function (DUF933) Back     alignment and domain information
>gnl|CDD|129200 TIGR00092, TIGR00092, GTP-binding protein YchF Back     alignment and domain information
>gnl|CDD|206687 cd01900, YchF, YchF GTPase Back     alignment and domain information
>gnl|CDD|133441 cd04938, TGS_Obg-like, TGS_Obg-like: The C-terminal TGS domain of Obg-like GTPases such as those present in DRG (developmentally regulated GTP-binding protein), and GTP-binding proteins Ygr210 and YchF Back     alignment and domain information
>gnl|CDD|133435 cd01616, TGS, The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 197
PRK09601364 GTP-binding protein YchF; Reviewed 100.0
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 100.0
PTZ00258390 GTP-binding protein; Provisional 100.0
COG0012372 Predicted GTPase, probable translation factor [Tra 100.0
KOG1491|consensus391 100.0
PF0607184 YchF-GTPase_C: Protein of unknown function (DUF933 100.0
cd0486783 TGS_YchF_C TGS_YchF_C: This subfamily represents T 100.0
PRK09602396 translation-associated GTPase; Reviewed 100.0
cd0493876 TGS_Obg-like TGS_Obg-like: The C-terminal TGS doma 99.85
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 99.79
COG1163365 DRG Predicted GTPase [General function prediction 99.68
cd0166976 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS doma 99.6
cd0166675 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulate 99.39
PF08438109 MMR_HSR1_C: GTPase of unknown function C-terminal; 98.86
PF0282460 TGS: TGS domain; InterPro: IPR004095 The TGS domai 98.64
KOG1486|consensus364 98.5
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.25
TIGR00691 683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 98.11
KOG1487|consensus358 98.06
PRK10872 743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 97.87
PRK11092 702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 97.27
COG0317 701 SpoT Guanosine polyphosphate pyrophosphohydrolases 97.12
cd0161660 TGS The TGS domain, named after the ThrRS, GTPase, 96.65
PRK12296500 obgE GTPase CgtA; Reviewed 95.16
cd01896233 DRG The developmentally regulated GTP-binding prot 95.07
PRK12297424 obgE GTPase CgtA; Reviewed 94.18
KOG1489|consensus366 92.78
cd0166860 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) prote 91.35
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 89.91
PRK0643767 hypothetical protein; Provisional 89.58
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 89.51
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 88.66
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 87.9
cd01881176 Obg_like The Obg-like subfamily consists of five w 87.71
PRK12298390 obgE GTPase CgtA; Reviewed 87.26
COG0536369 Obg Predicted GTPase [General function prediction 86.75
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 86.74
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 86.4
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 86.37
cd04171164 SelB SelB subfamily. SelB is an elongation factor 85.75
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 85.22
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 85.02
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 84.95
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 84.54
PRK12299335 obgE GTPase CgtA; Reviewed 84.49
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 84.28
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 84.21
COG5257415 GCD11 Translation initiation factor 2, gamma subun 84.16
PRK15467158 ethanolamine utilization protein EutP; Provisional 83.71
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 83.48
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 83.33
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 83.27
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 82.89
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 82.7
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 81.49
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 81.47
cd00881189 GTP_translation_factor GTP translation factor fami 80.57
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 80.39
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 80.12
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information 
Probab=100.00  E-value=1.7e-66  Score=470.87  Aligned_cols=180  Identities=44%  Similarity=0.763  Sum_probs=172.4

Q ss_pred             ChHHHHHhhcccccccCceEEEEeCCCccccccccccHHHHHHHHhhcCCCCeEEEechhhchhhcCCCHHHHHHHHHHh
Q psy17313          5 HHLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQ   84 (197)
Q Consensus         5 ~~~E~~~i~~~~lLT~KP~iyv~Nv~e~d~~~~~~~~~~~l~~~~~~~~~~~~vv~~sa~~E~el~~l~~ee~~~fl~~~   84 (197)
                      .++|.+.|++++|||+||||||+|++|.|+.. ++++++++++|+.++  +.++||+||++|.+|++|+++++++||+++
T Consensus       184 ~~~e~~~l~~~~llt~KP~i~v~N~~e~~~~~-~~~~~~~i~~~~~~~--~~~~i~~sa~~E~el~~l~~ee~~~fl~~~  260 (364)
T PRK09601        184 TDEEEKLLKSLQLLTAKPVLYVANVDEDDLAD-GNPYVKKVREIAAKE--GAEVVVICAKIEAEIAELDDEEKAEFLEEL  260 (364)
T ss_pred             CHHHHHHHHHhcccccCCeEEEEECCcccccc-ccHHHHHHHHHHHHc--CCeEEEEEHHHHHHHHcCCHHHHHHHHHHc
Confidence            35788999999999999999999999988753 688999999999876  678999999999999999999999999999


Q ss_pred             C-CcchHHHHHHHHHhhcCCeEEeecCCCceeeeEecCCCChhhhhhhhccccccCeeEEEEecchhhhhcCCHHHHHHc
Q psy17313         85 K-ATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAA  163 (197)
Q Consensus        85 g-~~sgl~~li~~~y~lL~LitffT~g~~EvRAWti~~GstA~~aAg~IHsDfekgFI~AeVi~~~D~~~~g~~~~ak~~  163 (197)
                      | .+||++++|+++|++||||+|||||++|||||||++|+|||||||+|||||+|||||||||+|+||+++||++.||++
T Consensus       261 g~~~s~~~~ii~~~~~~L~li~fftvg~~evrawti~~GstA~~aAg~IHsD~~kgFI~AeVi~~~d~~~~g~~~~ak~~  340 (364)
T PRK09601        261 GLEESGLDRLIRAGYELLGLITYFTAGPKEVRAWTIKKGTTAPQAAGVIHTDFEKGFIRAEVISYDDLIEYGSEAGAKEA  340 (364)
T ss_pred             CCcchhHHHHHHHHHHHhCCEEEecCCCCeEEEEEeCCCCchHHHhhcchhhHhhccEEEEEecHHHHHHcCCHHHHHHc
Confidence            9 889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccccCCceeecCCCEEEEEEcc
Q psy17313        164 GKYRQQGRAYTVEDGDIIFFKFNA  187 (197)
Q Consensus       164 Gk~r~eGkdYivqDGDIi~f~fn~  187 (197)
                      ||+|++||||+|||||||+||||+
T Consensus       341 gk~rleGkdY~v~DGDIi~f~fn~  364 (364)
T PRK09601        341 GKVRLEGKDYIVQDGDVMHFRFNV  364 (364)
T ss_pred             cceeccCCceEecCCCEEEEEcCC
Confidence            999999999999999999999996

>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>PF06071 YchF-GTPase_C: Protein of unknown function (DUF933); InterPro: IPR013029 This domain is found at the C terminus of family of conserved hypothetical proteins found in both prokaryotes and eukaryotes Back     alignment and domain information
>cd04867 TGS_YchF_C TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd04938 TGS_Obg-like TGS_Obg-like: The C-terminal TGS domain of Obg-like GTPases such as those present in DRG (developmentally regulated GTP-binding protein), and GTP-binding proteins Ygr210 and YchF Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01669 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS domain of Ygr210 GTP-binding protein which is a member of Obg-like family of GTPases, and present in archaea Back     alignment and domain information
>cd01666 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulated GTP-binding protein) represents a family of GTP-binding proteins that includes two members, DRG1 and DRG2 Back     alignment and domain information
>PF08438 MMR_HSR1_C: GTPase of unknown function C-terminal; InterPro: IPR013646 This domain is found at the C terminus of IPR002917 from INTERPRO in archaeal and eukaryotic GTP-binding proteins Back     alignment and domain information
>PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>cd01616 TGS The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
2ohf_A396 Crystal Structure Of Human Ola1 In Complex With Amp 6e-64
1ni3_A392 Structure Of The Schizosaccharomyces Pombe Ychf Gtp 3e-44
1jal_A363 Ychf Protein (Hi0393) Length = 363 2e-30
2dwq_A368 Thermus Thermophilus Ychf Gtp-Binding Protein Lengt 8e-29
2dby_A368 Crystal Structure Of The Gtp-Binding Protein Ychf I 2e-28
>pdb|2OHF|A Chain A, Crystal Structure Of Human Ola1 In Complex With Amppcp Length = 396 Back     alignment and structure 
Iteration: 1

 Score =  239 bits (611), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 120/188 (63%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
Query: 9   IEHLNKLNLLTAKTQIYLVNLSAKDYIXXXXXXXXXXXEWVDANDPGATIIPFSGVFEHQ 68
           IE LNK   LT+K  +YLVNLS KDYI           EWVD  DPGA +IPFSG  E +
Sbjct: 211 IEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELK 270
Query: 69  LVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQA 128
           L ++  +ERQ+YL+     S L KII  G+ +LQL+YFFTAG DEV+AWTI+KGTKAPQA
Sbjct: 271 LQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQA 330
Query: 129 AGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAG 188
           AG+IHTDFEKGFIMAEVM ++DFKE GSE A +AAGKYRQQGR Y VEDGDIIFFKFN  
Sbjct: 331 AGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTP 390
Query: 189 AGLNPKKK 196
               PKKK
Sbjct: 391 Q--QPKKK 396
>pdb|1NI3|A Chain A, Structure Of The Schizosaccharomyces Pombe Ychf Gtpase Length = 392 Back     alignment and structure
>pdb|1JAL|A Chain A, Ychf Protein (Hi0393) Length = 363 Back     alignment and structure
>pdb|2DWQ|A Chain A, Thermus Thermophilus Ychf Gtp-Binding Protein Length = 368 Back     alignment and structure
>pdb|2DBY|A Chain A, Crystal Structure Of The Gtp-Binding Protein Ychf In Complexed With Gdp Length = 368 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 1e-109
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 1e-105
1jal_A363 YCHF protein; nucleotide-binding fold, structural 8e-72
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 2e-70
1wxq_A397 GTP-binding protein; structural genomics, riken st 7e-33
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Length = 396 Back     alignment and structure
 Score =  317 bits (815), Expect = e-109
 Identities = 129/188 (68%), Positives = 148/188 (78%), Gaps = 2/188 (1%)

Query: 9   IEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQ 68
           IE LNK   LT+K  +YLVNLS KDYI+KKNKWL KIKEWVD  DPGA +IPFSG  E +
Sbjct: 211 IEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELK 270

Query: 69  LVDMPDDERQRYLDEQKATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQA 128
           L ++  +ERQ+YL+     S L KII  G+ +LQL+YFFTAG DEV+AWTI+KGTKAPQA
Sbjct: 271 LQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQA 330

Query: 129 AGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIFFKFNAG 188
           AG+IHTDFEKGFIMAEVM ++DFKE GSE A +AAGKYRQQGR Y VEDGDIIFFKFN  
Sbjct: 331 AGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTP 390

Query: 189 AGLNPKKK 196
               PKKK
Sbjct: 391 QQ--PKKK 396
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Length = 392 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Length = 363 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Length = 368 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Length = 397 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 100.0
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 100.0
1jal_A363 YCHF protein; nucleotide-binding fold, structural 100.0
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 100.0
1wxq_A397 GTP-binding protein; structural genomics, riken st 100.0
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 100.0
2eki_A93 DRG 1, developmentally-regulated GTP-binding prote 99.57
3hvz_A78 Uncharacterized protein; alpha-beta protein, struc 98.39
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 95.25
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 95.24
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 93.38
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 91.01
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 90.44
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 90.33
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 90.33
3t1o_A198 Gliding protein MGLA; G domain containing protein, 90.31
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 90.27
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 90.05
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 89.46
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 89.32
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 89.25
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 89.22
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 89.04
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 88.81
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 88.68
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 88.6
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 88.48
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 88.45
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 88.25
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 88.2
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 87.98
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 87.95
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 87.93
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 87.06
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 87.03
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 87.0
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 86.78
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 86.72
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 86.63
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 86.59
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 86.51
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 86.09
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 86.04
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 86.01
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 85.88
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 85.83
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 85.68
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 85.67
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 85.5
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 85.47
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 85.33
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 84.94
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 84.84
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 84.77
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 84.62
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 84.39
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 84.29
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 84.09
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 84.06
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 83.74
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 83.66
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 83.44
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 83.09
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 82.87
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 82.78
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 82.63
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 82.17
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 82.03
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 81.8
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 81.72
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 81.54
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 81.07
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 81.05
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 81.01
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 80.86
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 80.83
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 80.74
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 80.53
2hf9_A226 Probable hydrogenase nickel incorporation protein 80.43
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 80.42
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 80.2
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 80.11
1wwt_A88 Threonyl-tRNA synthetase, cytoplasmic; TGS domain, 80.1
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
Probab=100.00  E-value=2.6e-67  Score=477.90  Aligned_cols=182  Identities=51%  Similarity=0.897  Sum_probs=171.3

Q ss_pred             hHHHHHhhcccccccCceEEEEeCCCccccccccccHHHHHHHHhhcCCCCeEEEechhhchhhcCCCHHHHHHHHHHhC
Q psy17313          6 HLRIEHLNKLNLLTAKTQIYLVNLSAKDYIKKKNKWLPKIKEWVDANDPGATIIPFSGVFEHQLVDMPDDERQRYLDEQK   85 (197)
Q Consensus         6 ~~E~~~i~~~~lLT~KP~iyv~Nv~e~d~~~~~~~~~~~l~~~~~~~~~~~~vv~~sa~~E~el~~l~~ee~~~fl~~~g   85 (197)
                      ++|+++|+.+.|+|+||++|++|++|.++.+..|++++++++|+++++|+.++||+||++|.+|++|+++|+++||+++|
T Consensus       210 ~~e~e~i~~~~~lt~kp~~y~~Nv~e~~~~~~~~~~~~~~~~~~~~~~p~~~~v~~sa~~E~~l~~l~~~~~~~~l~~~g  289 (392)
T 1ni3_A          210 NREVEIINSLYLLTAKPVIYLVNMSERDFLRQKNKYLPKIKKWIDENSPGDTLIPMSVAFEERLTNFTEEEAIEECKKLN  289 (392)
T ss_dssp             HHHHHHHHTTCCGGGSCEEEEEECCHHHHTTTCCSSHHHHHHHHHTTSTTCCEEEECHHHHHHHTTSCHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHhhhccCceEEEEEecchhhcccchHHHHHHHHHHHhcCCCCeEEEEEhHHHHHHhhCCHHHHHHHHHHhC
Confidence            46788999999999999999999999887633589999999999887666889999999999999999999999999999


Q ss_pred             CcchHHHHHHHHHhhcCCeEEeecCCCceeeeEecCCCChhhhhhhhccccccCeeEEEEecchhhhhcCCHHHHHHcCc
Q psy17313         86 ATSVLDKIITQGYKSLQLQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGK  165 (197)
Q Consensus        86 ~~sgl~~li~~~y~lL~LitffT~g~~EvRAWti~~GstA~~aAg~IHsDfekgFI~AeVi~~~D~~~~g~~~~ak~~Gk  165 (197)
                      .+|||+++|+++|++||||+|||+||+|+|||||++|+|||||||+|||||+|||||||||+|+||+++||+++||++||
T Consensus       290 ~~~gl~~~i~~~~~~L~l~~~ft~g~~e~rawti~~G~~a~~aag~IH~d~~~gfi~ae~~~~~d~~~~g~~~~~k~~g~  369 (392)
T 1ni3_A          290 TKSMLPKIIVTGYNALNLINYFTCGEDEVRSWTIRKGTKAPQAAGVIHTDFEKAFVVGEIMHYQDLFDYKTENACRAAGK  369 (392)
T ss_dssp             CCCSHHHHHHHHHHHTTEEEEEECCSSEEEEEEEETTCBHHHHHHHHCHHHHHTCSEEEEECHHHHHHHTSHHHHHHTTC
T ss_pred             CcccHHHHHHHHHHHhCCEEEECCCCCcceeEEeCCCCcHHHHccccchhhhhccEEEEECCHHHHHHcCCHHHHHHcCC
Confidence            88999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCceeecCCCEEEEEEcc
Q psy17313        166 YRQQGRAYTVEDGDIIFFKFNA  187 (197)
Q Consensus       166 ~r~eGkdYivqDGDIi~f~fn~  187 (197)
                      +|++||||+|||||||+||||+
T Consensus       370 ~r~~gk~y~v~dgdv~~f~f~~  391 (392)
T 1ni3_A          370 YLTKGKEYVMESGDIAHWKAGK  391 (392)
T ss_dssp             SCEEETTCBCCTTCEEECC---
T ss_pred             ccccCCceeeeCCCEEEEEccC
Confidence            9999999999999999999997
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2eki_A DRG 1, developmentally-regulated GTP-binding protein 1; protein NEDD3, neural precursor cell expressed developmentally DOWN-regulated protein 3; NMR {Homo sapiens} Back     alignment and structure
>3hvz_A Uncharacterized protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.20A {Clostridium leptum} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1wwt_A Threonyl-tRNA synthetase, cytoplasmic; TGS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ligase; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 197
d1jala285 d.15.10.2 (A:279-363) YchF GTP-binding protein, C- 4e-45
d1ni3a282 d.15.10.2 (A:307-388) YchF GTP-binding protein, C- 2e-42
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 4e-21
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 1e-13
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 1e-11
d1wxqa276 d.15.10.2 (A:320-395) GTP-binding protein PH0525 { 0.001
>d1jala2 d.15.10.2 (A:279-363) YchF GTP-binding protein, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 85 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: TGS-like
family: G domain-linked domain
domain: YchF GTP-binding protein, C-terminal domain
species: Haemophilus influenzae [TaxId: 727]

 Score =  142 bits (359), Expect = 4e-45
 Identities = 45/84 (53%), Positives = 61/84 (72%)

Query: 103 LQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRA 162
           LQ +FTAG  EV+AWT+  G  AP+AA  IHTDFEKGFI AEV+ ++DF +   E   + 
Sbjct: 1   LQTYFTAGVKEVRAWTVSVGATAPKAAAVIHTDFEKGFIRAEVIAYEDFIQFNGENGAKE 60

Query: 163 AGKYRQQGRAYTVEDGDIIFFKFN 186
           AGK+R +G+ Y V+DGD++ F+FN
Sbjct: 61  AGKWRLEGKDYIVQDGDVMHFRFN 84
>d1ni3a2 d.15.10.2 (A:307-388) YchF GTP-binding protein, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 82 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
d1jala285 YchF GTP-binding protein, C-terminal domain {Haemo 100.0
d1ni3a282 YchF GTP-binding protein, C-terminal domain {Fissi 100.0
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.85
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.79
d1wxqa276 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.46
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.93
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.08
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 94.88
d1nyra259 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 94.57
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 94.06
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 93.29
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 91.75
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.68
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 90.59
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 88.66
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.04
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 86.92
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.78
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 86.6
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 86.31
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 86.08
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 86.07
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 85.84
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 85.55
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 85.38
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 85.36
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 85.16
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 84.7
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 84.7
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 84.23
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 83.93
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 83.8
d2hj1a177 Hypothetical protein HI0395 {Haemophilus influenza 83.29
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 83.29
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 83.19
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 82.75
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 82.7
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 81.82
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 81.2
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 81.02
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 80.84
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 80.82
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 80.82
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 80.71
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 80.51
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 80.47
>d1jala2 d.15.10.2 (A:279-363) YchF GTP-binding protein, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: TGS-like
family: G domain-linked domain
domain: YchF GTP-binding protein, C-terminal domain
species: Haemophilus influenzae [TaxId: 727]

Probab=100.00  E-value=2.4e-51  Score=300.05  Aligned_cols=85  Identities=53%  Similarity=0.976  Sum_probs=84.3

Q ss_pred             CeEEeecCCCceeeeEecCCCChhhhhhhhccccccCeeEEEEecchhhhhcCCHHHHHHcCcccccCCceeecCCCEEE
Q psy17313        103 LQYFFTAGQDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFDDFKEHGSEAACRAAGKYRQQGRAYTVEDGDIIF  182 (197)
Q Consensus       103 LitffT~g~~EvRAWti~~GstA~~aAg~IHsDfekgFI~AeVi~~~D~~~~g~~~~ak~~Gk~r~eGkdYivqDGDIi~  182 (197)
                      |+||||+||+|+|||||++|+|||||||+|||||+|||||||||+|+||+++||++.+|++||+|++||||+|||||||+
T Consensus         1 L~tFfT~G~~E~raWti~~G~~Ap~AAG~IHsDfekgFIrAeVi~~~d~i~~g~~~~~k~~Gk~r~eGKdYiv~DGDii~   80 (85)
T d1jala2           1 LQTYFTAGVKEVRAWTVSVGATAPKAAAVIHTDFEKGFIRAEVIAYEDFIQFNGENGAKEAGKWRLEGKDYIVQDGDVMH   80 (85)
T ss_dssp             EEEEEEECSSEEEEEEEETTCBHHHHHHTTCTTHHHHCCEEEEECHHHHHHTTSHHHHHHTTCCEEECTTCBCCTTCEEE
T ss_pred             CcceecCCCCeeEEeecccccchhhhhCceechhhhCcEEEEEEcHHHHHHcCCHHHHHHcCcchhhCCCCcEeCCCEEE
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEcc
Q psy17313        183 FKFNA  187 (197)
Q Consensus       183 f~fn~  187 (197)
                      |+|||
T Consensus        81 F~fNV   85 (85)
T d1jala2          81 FRFNV   85 (85)
T ss_dssp             EESCC
T ss_pred             EEecC
Confidence            99997
>d1ni3a2 d.15.10.2 (A:307-388) YchF GTP-binding protein, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyra2 d.15.10.1 (A:4-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2hj1a1 d.15.3.4 (A:11-87) Hypothetical protein HI0395 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure