Diaphorina citri psyllid: psy17316

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MMITPELLGLLPSSNYSDGETDKAGSLTVTKTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGIHTPKKEGPTKSWNEEILNVALDALRAGSISANKASKAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNASPTAWKPEDLEIALEGIRSGQTTVQRASAEYGIPSGTLYGRCKLSRSTPRPPPGNLKTSR
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHccccccccccccccccc
***T**************************KTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGIHT********SWNEEILNVALDALRAGSI**********PTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNASPTAWKPEDLEIALEGIRS*****QRASAEYGIPSGTLYGRC******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMITPELLGLLPSSNYSDGETDKAGSLTVTKTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGIHTPKKEGPTKSWNEEILNVALDALRAGSISANKASKAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNASPTAWKPEDLEIALEGIRSGQTTVQRASAEYGIPSGTLYGRCKLSRSTPRPPPGNLKTSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0031519 [CC]PcG protein complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0031935 [BP]regulation of chromatin silencingprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468, GO:0060968
GO:0006342 [BP]chromatin silencingprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0042048 [BP]olfactory behaviorprobableGO:0007635, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0042221
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0008595 [BP]anterior/posterior axis specification, embryoprobableGO:0032502, GO:0007389, GO:0032501, GO:0009952, GO:0044707, GO:0009948, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0008150, GO:0003002, GO:0000578, GO:0009798, GO:0007351, GO:0007350, GO:0035282, GO:0044699, GO:0009880

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2COB, chain A
Confidence level:very confident
Coverage over the Query: 27-76
View the alignment between query and template
View the model in PyMOL
Template: 2COB, chain A
Confidence level:very confident
Coverage over the Query: 113-165
View the alignment between query and template
View the model in PyMOL
Template: 1U78, chain A
Confidence level:confident
Coverage over the Query: 30-81,113-160
View the alignment between query and template
View the model in PyMOL
Template: 2K27, chain A
Confidence level:confident
Coverage over the Query: 100-214
View the alignment between query and template
View the model in PyMOL