Psyllid ID: psy17316
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 229 | ||||||
| 345491641 | 657 | PREDICTED: hypothetical protein LOC10012 | 0.820 | 0.286 | 0.625 | 2e-68 | |
| 383864280 | 675 | PREDICTED: uncharacterized protein LOC10 | 0.820 | 0.278 | 0.612 | 2e-67 | |
| 350400311 | 648 | PREDICTED: hypothetical protein LOC10074 | 0.820 | 0.290 | 0.612 | 1e-66 | |
| 340717913 | 645 | PREDICTED: hypothetical protein LOC10064 | 0.820 | 0.291 | 0.612 | 1e-66 | |
| 58585152 | 652 | pipsqueak [Apis mellifera] gi|3746878|gb | 0.820 | 0.288 | 0.612 | 2e-66 | |
| 380012351 | 648 | PREDICTED: uncharacterized protein LOC10 | 0.820 | 0.290 | 0.612 | 2e-66 | |
| 193683716 | 701 | PREDICTED: hypothetical protein LOC10015 | 0.820 | 0.268 | 0.583 | 2e-66 | |
| 322794753 | 540 | hypothetical protein SINV_02021 [Solenop | 0.820 | 0.348 | 0.595 | 3e-65 | |
| 242004638 | 698 | pipsqueak, putative [Pediculus humanus c | 0.803 | 0.263 | 0.595 | 3e-65 | |
| 332026413 | 517 | hypothetical protein G5I_05017 [Acromyrm | 0.820 | 0.363 | 0.595 | 3e-65 |
| >gi|345491641|ref|XP_001607008.2| PREDICTED: hypothetical protein LOC100123373 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 264 bits (675), Expect = 2e-68, Method: Compositional matrix adjust.
Identities = 147/235 (62%), Positives = 165/235 (70%), Gaps = 47/235 (20%)
Query: 1 MMITPELLGLLPS--SNYSD-GETD------KAGSLTV-TKTWTHEDMDAALEALRAGQM 50
MMITPELLGL+PS S +SD GE + ++GS +K+WT EDMDAALEALR M
Sbjct: 373 MMITPELLGLMPSGSSVHSDSGENNSRTHSGQSGSHHHGSKSWTQEDMDAALEALRNHDM 432
Query: 51 SLTKASVSYGIPSTTLWQRAHRLGIHTPKKEGPTKSWNEEILNVALDALRAGSISANKAS 110
SLTKAS ++GIPSTTLWQRAHRLGI TPKK+GPTKSW++E LN ALDALR G+ISANKAS
Sbjct: 433 SLTKASATFGIPSTTLWQRAHRLGIETPKKDGPTKSWSDESLNNALDALRTGTISANKAS 492
Query: 111 KAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNAS 170
KA +GIPSSTLYKIAR+EGIRLA PFNAS
Sbjct: 493 KA--------------------------------FGIPSSTLYKIARREGIRLAAPFNAS 520
Query: 171 PTAWKPEDLEIALEGIRSGQTTVQRASAEYGIPSGTLYGRCK-----LSRSTPRP 220
PT W P DL+ ALE IRSGQT+VQRA+ EYGIPSGTLYGRCK LSRS P P
Sbjct: 521 PTTWSPADLDRALEAIRSGQTSVQRAATEYGIPSGTLYGRCKREGIELSRSNPTP 575
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383864280|ref|XP_003707607.1| PREDICTED: uncharacterized protein LOC100880546 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350400311|ref|XP_003485795.1| PREDICTED: hypothetical protein LOC100749194 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340717913|ref|XP_003397418.1| PREDICTED: hypothetical protein LOC100649846 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|58585152|ref|NP_001011602.1| pipsqueak [Apis mellifera] gi|3746878|gb|AAC71015.1| pipsqueak [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380012351|ref|XP_003690248.1| PREDICTED: uncharacterized protein LOC100864657 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|193683716|ref|XP_001947249.1| PREDICTED: hypothetical protein LOC100159948 isoform 1 [Acyrthosiphon pisum] gi|328700169|ref|XP_003241167.1| PREDICTED: hypothetical protein LOC100159948 isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|322794753|gb|EFZ17700.1| hypothetical protein SINV_02021 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|242004638|ref|XP_002423187.1| pipsqueak, putative [Pediculus humanus corporis] gi|212506152|gb|EEB10449.1| pipsqueak, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|332026413|gb|EGI66542.1| hypothetical protein G5I_05017 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 229 | ||||||
| FB|FBgn0263102 | 1085 | psq "pipsqueak" [Drosophila me | 0.480 | 0.101 | 0.730 | 1.7e-39 | |
| WB|WBGene00011315 | 433 | mbr-1 [Caenorhabditis elegans | 0.187 | 0.099 | 0.395 | 6.8e-05 | |
| UNIPROTKB|G3N278 | 601 | LCORL "Uncharacterized protein | 0.262 | 0.099 | 0.327 | 0.0001 | |
| UNIPROTKB|Q95YM8 | 1598 | Mblk-1 "Mushroom body large-ty | 0.196 | 0.028 | 0.333 | 0.00026 | |
| UNIPROTKB|F1P637 | 558 | LCORL "Uncharacterized protein | 0.244 | 0.100 | 0.333 | 0.00042 | |
| UNIPROTKB|D3K5M5 | 603 | LCORL "Ligand dependent nuclea | 0.244 | 0.092 | 0.333 | 0.0005 | |
| UNIPROTKB|F1NH98 | 551 | LCORL "Ligand-dependent nuclea | 0.244 | 0.101 | 0.333 | 0.00051 | |
| UNIPROTKB|Q5ZJK5 | 600 | LCORL "Ligand-dependent nuclea | 0.244 | 0.093 | 0.333 | 0.00063 |
| FB|FBgn0263102 psq "pipsqueak" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 419 (152.6 bits), Expect = 1.7e-39, Sum P(2) = 1.7e-39
Identities = 84/115 (73%), Positives = 95/115 (82%)
Query: 111 KAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNAS 170
K G TKSWNE+ L AL+ALR+G ISANKASKA+GIPSSTLYKIAR+EGIRLA PFNA+
Sbjct: 773 KKEGGTKSWNEDALQNALEALRSGQISANKASKAFGIPSSTLYKIARREGIRLAAPFNAA 832
Query: 171 PTAWKPEDLEIALEGIRSGQTTVQRASAEYGIPSGTLYGRCK-----LSRSTPRP 220
PT W PEDLE ALE IR+G T+VQ+ASAE+GIP+GTLYGRCK LSRS P P
Sbjct: 833 PTTWTPEDLERALEAIRAGNTSVQKASAEFGIPTGTLYGRCKREGIELSRSNPTP 887
|
|
| WB|WBGene00011315 mbr-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N278 LCORL "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q95YM8 Mblk-1 "Mushroom body large-type Kenyon cell-specific protein 1" [Apis mellifera (taxid:7460)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P637 LCORL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D3K5M5 LCORL "Ligand dependent nuclear receptor corepressor-like protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NH98 LCORL "Ligand-dependent nuclear receptor corepressor-like protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZJK5 LCORL "Ligand-dependent nuclear receptor corepressor-like protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 229 | |||
| pfam05225 | 43 | pfam05225, HTH_psq, helix-turn-helix, Psq domain | 3e-10 | |
| pfam05225 | 43 | pfam05225, HTH_psq, helix-turn-helix, Psq domain | 2e-07 | |
| pfam05225 | 43 | pfam05225, HTH_psq, helix-turn-helix, Psq domain | 2e-07 |
| >gnl|CDD|203213 pfam05225, HTH_psq, helix-turn-helix, Psq domain | Back alignment and domain information |
|---|
Score = 53.3 bits (129), Expect = 3e-10
Identities = 22/44 (50%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
Query: 36 EDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGIHTPK 79
ED+ ALEA+R G+MSL KA+ YGIP +TLW R R +
Sbjct: 1 EDLAEALEAVRNGKMSLRKAARKYGIPRSTLW-RRLRGKYSLKR 43
|
This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster. In pipsqueak this domain binds to GAGA sequence. Length = 43 |
| >gnl|CDD|203213 pfam05225, HTH_psq, helix-turn-helix, Psq domain | Back alignment and domain information |
|---|
| >gnl|CDD|203213 pfam05225, HTH_psq, helix-turn-helix, Psq domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| PF01710 | 119 | HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr | 99.2 | |
| PF05225 | 45 | HTH_psq: helix-turn-helix, Psq domain; InterPro: I | 99.05 | |
| COG3415 | 138 | Transposase and inactivated derivatives [DNA repli | 99.03 | |
| PF01710 | 119 | HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr | 98.93 | |
| COG3415 | 138 | Transposase and inactivated derivatives [DNA repli | 98.89 | |
| PF05225 | 45 | HTH_psq: helix-turn-helix, Psq domain; InterPro: I | 98.82 | |
| cd00131 | 128 | PAX Paired Box domain | 98.81 | |
| smart00351 | 125 | PAX Paired Box domain. | 98.7 | |
| COG2963 | 116 | Transposase and inactivated derivatives [DNA repli | 98.66 | |
| PF13551 | 112 | HTH_29: Winged helix-turn helix | 98.63 | |
| PF13551 | 112 | HTH_29: Winged helix-turn helix | 98.63 | |
| cd00131 | 128 | PAX Paired Box domain | 98.58 | |
| PF01527 | 76 | HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp | 98.57 | |
| PF01527 | 76 | HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp | 98.54 | |
| smart00351 | 125 | PAX Paired Box domain. | 98.49 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 98.47 | |
| COG2963 | 116 | Transposase and inactivated derivatives [DNA repli | 98.46 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 98.42 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 98.4 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 98.4 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 98.38 | |
| PF13384 | 50 | HTH_23: Homeodomain-like domain; PDB: 2X48_C. | 98.34 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 98.25 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 98.23 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 98.09 | |
| PF13936 | 44 | HTH_38: Helix-turn-helix domain; PDB: 2W48_A. | 97.98 | |
| PF13384 | 50 | HTH_23: Homeodomain-like domain; PDB: 2X48_C. | 97.97 | |
| cd01104 | 68 | HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain | 97.8 | |
| PF06056 | 58 | Terminase_5: Putative ATPase subunit of terminase | 97.79 | |
| PF09607 | 58 | BrkDBD: Brinker DNA-binding domain; InterPro: IPR0 | 97.74 | |
| cd01104 | 68 | HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain | 97.73 | |
| PF13936 | 44 | HTH_38: Helix-turn-helix domain; PDB: 2W48_A. | 97.68 | |
| PF06056 | 58 | Terminase_5: Putative ATPase subunit of terminase | 97.65 | |
| cd00569 | 42 | HTH_Hin_like Helix-turn-helix domain of Hin and re | 97.63 | |
| cd04764 | 67 | HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom | 97.63 | |
| PF13011 | 85 | LZ_Tnp_IS481: leucine-zipper of insertion element | 97.62 | |
| cd00569 | 42 | HTH_Hin_like Helix-turn-helix domain of Hin and re | 97.56 | |
| PF13411 | 69 | MerR_1: MerR HTH family regulatory protein; PDB: 2 | 97.43 | |
| PF09862 | 113 | DUF2089: Protein of unknown function (DUF2089); In | 97.41 | |
| PF13011 | 85 | LZ_Tnp_IS481: leucine-zipper of insertion element | 97.34 | |
| cd04763 | 68 | HTH_MlrA-like Helix-Turn-Helix DNA binding domain | 97.32 | |
| PRK13413 | 200 | mpi multiple promoter invertase; Provisional | 97.27 | |
| PF13411 | 69 | MerR_1: MerR HTH family regulatory protein; PDB: 2 | 97.24 | |
| cd04763 | 68 | HTH_MlrA-like Helix-Turn-Helix DNA binding domain | 97.18 | |
| PF13565 | 77 | HTH_32: Homeodomain-like domain | 97.17 | |
| cd04764 | 67 | HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom | 97.14 | |
| cd04762 | 49 | HTH_MerR-trunc Helix-Turn-Helix DNA binding domain | 97.11 | |
| smart00342 | 84 | HTH_ARAC helix_turn_helix, arabinose operon contro | 97.1 | |
| PHA02535 | 581 | P terminase ATPase subunit; Provisional | 97.08 | |
| KOG4565|consensus | 206 | 97.05 | ||
| PF09607 | 58 | BrkDBD: Brinker DNA-binding domain; InterPro: IPR0 | 97.04 | |
| PF02954 | 42 | HTH_8: Bacterial regulatory protein, Fis family; I | 96.97 | |
| PRK11511 | 127 | DNA-binding transcriptional activator MarA; Provis | 96.9 | |
| PRK10219 | 107 | DNA-binding transcriptional regulator SoxS; Provis | 96.89 | |
| PF09862 | 113 | DUF2089: Protein of unknown function (DUF2089); In | 96.86 | |
| smart00422 | 70 | HTH_MERR helix_turn_helix, mercury resistance. | 96.81 | |
| PF12116 | 82 | SpoIIID: Stage III sporulation protein D; InterPro | 96.81 | |
| cd04788 | 96 | HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain | 96.78 | |
| PHA00675 | 78 | hypothetical protein | 96.78 | |
| smart00342 | 84 | HTH_ARAC helix_turn_helix, arabinose operon contro | 96.77 | |
| PHA02535 | 581 | P terminase ATPase subunit; Provisional | 96.75 | |
| KOG4565|consensus | 206 | 96.74 | ||
| cd01105 | 88 | HTH_GlnR-like Helix-Turn-Helix DNA binding domain | 96.67 | |
| cd04788 | 96 | HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain | 96.66 | |
| cd01106 | 103 | HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain | 96.64 | |
| smart00422 | 70 | HTH_MERR helix_turn_helix, mercury resistance. | 96.62 | |
| cd01105 | 88 | HTH_GlnR-like Helix-Turn-Helix DNA binding domain | 96.61 | |
| PF00292 | 125 | PAX: 'Paired box' domain; InterPro: IPR001523 The | 96.61 | |
| cd04765 | 99 | HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding dom | 96.61 | |
| cd04762 | 49 | HTH_MerR-trunc Helix-Turn-Helix DNA binding domain | 96.55 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 96.55 | |
| smart00421 | 58 | HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo | 96.55 | |
| cd04765 | 99 | HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding dom | 96.53 | |
| PRK13182 | 175 | racA polar chromosome segregation protein; Reviewe | 96.52 | |
| PF10668 | 60 | Phage_terminase: Phage terminase small subunit; In | 96.5 | |
| TIGR02531 | 88 | yecD_yerC TrpR-related protein YerC/YecD. This mod | 96.49 | |
| TIGR01764 | 49 | excise DNA binding domain, excisionase family. An | 96.48 | |
| smart00421 | 58 | HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo | 96.46 | |
| COG2826 | 318 | Tra8 Transposase and inactivated derivatives, IS30 | 96.46 | |
| cd04761 | 49 | HTH_MerR-SF Helix-Turn-Helix DNA binding domain of | 96.43 | |
| PF02954 | 42 | HTH_8: Bacterial regulatory protein, Fis family; I | 96.42 | |
| cd04768 | 96 | HTH_BmrR-like Helix-Turn-Helix DNA binding domain | 96.38 | |
| PRK11511 | 127 | DNA-binding transcriptional activator MarA; Provis | 96.3 | |
| PF13542 | 52 | HTH_Tnp_ISL3: Helix-turn-helix domain of transposa | 96.27 | |
| PF02042 | 52 | RWP-RK: RWP-RK domain; InterPro: IPR003035 This do | 96.25 | |
| PRK04217 | 110 | hypothetical protein; Provisional | 96.23 | |
| cd04782 | 97 | HTH_BltR Helix-Turn-Helix DNA binding domain of th | 96.22 | |
| PF13565 | 77 | HTH_32: Homeodomain-like domain | 96.22 | |
| cd04768 | 96 | HTH_BmrR-like Helix-Turn-Helix DNA binding domain | 96.21 | |
| cd04775 | 102 | HTH_Cfa-like Helix-Turn-Helix DNA binding domain o | 96.16 | |
| COG1342 | 99 | Predicted DNA-binding proteins [General function p | 96.16 | |
| cd01106 | 103 | HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain | 96.15 | |
| PRK13413 | 200 | mpi multiple promoter invertase; Provisional | 96.14 | |
| cd01109 | 113 | HTH_YyaN Helix-Turn-Helix DNA binding domain of th | 96.13 | |
| cd01282 | 112 | HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding dom | 96.11 | |
| TIGR02531 | 88 | yecD_yerC TrpR-related protein YerC/YecD. This mod | 96.1 | |
| PF12728 | 51 | HTH_17: Helix-turn-helix domain | 96.1 | |
| PF10668 | 60 | Phage_terminase: Phage terminase small subunit; In | 96.1 | |
| cd00592 | 100 | HTH_MerR-like Helix-Turn-Helix DNA binding domain | 96.07 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 96.06 | |
| cd01110 | 139 | HTH_SoxR Helix-Turn-Helix DNA binding domain of th | 96.06 | |
| PF13542 | 52 | HTH_Tnp_ISL3: Helix-turn-helix domain of transposa | 96.05 | |
| PF13309 | 64 | HTH_22: HTH domain | 96.04 | |
| cd01109 | 113 | HTH_YyaN Helix-Turn-Helix DNA binding domain of th | 96.01 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 95.99 | |
| cd01282 | 112 | HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding dom | 95.99 | |
| PRK15044 | 295 | transcriptional regulator SirC; Provisional | 95.98 | |
| PF07900 | 220 | DUF1670: Protein of unknown function (DUF1670); In | 95.98 | |
| PRK15186 | 291 | AraC family transcriptional regulator; Provisional | 95.97 | |
| cd00592 | 100 | HTH_MerR-like Helix-Turn-Helix DNA binding domain | 95.96 | |
| cd01110 | 139 | HTH_SoxR Helix-Turn-Helix DNA binding domain of th | 95.92 | |
| cd04775 | 102 | HTH_Cfa-like Helix-Turn-Helix DNA binding domain o | 95.91 | |
| cd01107 | 108 | HTH_BmrR Helix-Turn-Helix DNA binding domain of th | 95.91 | |
| cd04790 | 172 | HTH_Cfa-like_unk Helix-Turn-Helix DNA binding doma | 95.89 | |
| TIGR01321 | 94 | TrpR trp operon repressor, proteobacterial. This m | 95.89 | |
| PRK01905 | 77 | DNA-binding protein Fis; Provisional | 95.89 | |
| PRK04217 | 110 | hypothetical protein; Provisional | 95.87 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 95.86 | |
| cd01107 | 108 | HTH_BmrR Helix-Turn-Helix DNA binding domain of th | 95.85 | |
| TIGR01764 | 49 | excise DNA binding domain, excisionase family. An | 95.85 | |
| PRK10219 | 107 | DNA-binding transcriptional regulator SoxS; Provis | 95.84 | |
| cd04785 | 126 | HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding do | 95.83 | |
| cd04780 | 95 | HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding dom | 95.82 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 95.75 | |
| cd04774 | 96 | HTH_YfmP Helix-Turn-Helix DNA binding domain of th | 95.75 | |
| cd04782 | 97 | HTH_BltR Helix-Turn-Helix DNA binding domain of th | 95.74 | |
| cd04780 | 95 | HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding dom | 95.73 | |
| cd06171 | 55 | Sigma70_r4 Sigma70, region (SR) 4 refers to the mo | 95.72 | |
| TIGR01321 | 94 | TrpR trp operon repressor, proteobacterial. This m | 95.72 | |
| cd04789 | 102 | HTH_Cfa Helix-Turn-Helix DNA binding domain of the | 95.71 | |
| cd04761 | 49 | HTH_MerR-SF Helix-Turn-Helix DNA binding domain of | 95.7 | |
| cd04773 | 108 | HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding | 95.69 | |
| cd04789 | 102 | HTH_Cfa Helix-Turn-Helix DNA binding domain of the | 95.68 | |
| cd04781 | 120 | HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding dom | 95.68 | |
| cd04781 | 120 | HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding dom | 95.66 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 95.61 | |
| PRK09978 | 274 | DNA-binding transcriptional regulator GadX; Provis | 95.61 | |
| PRK01381 | 99 | Trp operon repressor; Provisional | 95.57 | |
| PF02001 | 106 | DUF134: Protein of unknown function DUF134; InterP | 95.56 | |
| cd01108 | 127 | HTH_CueR Helix-Turn-Helix DNA binding domain of Cu | 95.55 | |
| PRK15185 | 309 | transcriptional regulator HilD; Provisional | 95.53 | |
| cd01279 | 98 | HTH_HspR-like Helix-Turn-Helix DNA binding domain | 95.52 | |
| cd06170 | 57 | LuxR_C_like C-terminal DNA-binding domain of LuxR- | 95.52 | |
| cd01111 | 107 | HTH_MerD Helix-Turn-Helix DNA binding domain of th | 95.5 | |
| cd04770 | 123 | HTH_HMRTR Helix-Turn-Helix DNA binding domain of H | 95.46 | |
| cd04773 | 108 | HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding | 95.45 | |
| cd04774 | 96 | HTH_YfmP Helix-Turn-Helix DNA binding domain of th | 95.44 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 95.43 | |
| cd04767 | 120 | HTH_HspR-like_MBC Helix-Turn-Helix DNA binding dom | 95.41 | |
| TIGR02043 | 131 | ZntR Zn(II)-responsive transcriptional regulator. | 95.39 | |
| cd01108 | 127 | HTH_CueR Helix-Turn-Helix DNA binding domain of Cu | 95.36 | |
| PF12116 | 82 | SpoIIID: Stage III sporulation protein D; InterPro | 95.35 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 95.34 | |
| cd04783 | 126 | HTH_MerR1 Helix-Turn-Helix DNA binding domain of t | 95.32 | |
| cd06170 | 57 | LuxR_C_like C-terminal DNA-binding domain of LuxR- | 95.31 | |
| PF12728 | 51 | HTH_17: Helix-turn-helix domain | 95.31 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 95.3 | |
| cd04769 | 116 | HTH_MerR2 Helix-Turn-Helix DNA binding domain of M | 95.28 | |
| PRK13182 | 175 | racA polar chromosome segregation protein; Reviewe | 95.28 | |
| PRK15043 | 243 | transcriptional regulator MirA; Provisional | 95.26 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 95.23 | |
| TIGR02043 | 131 | ZntR Zn(II)-responsive transcriptional regulator. | 95.23 | |
| cd01279 | 98 | HTH_HspR-like Helix-Turn-Helix DNA binding domain | 95.21 | |
| PF13613 | 53 | HTH_Tnp_4: Helix-turn-helix of DDE superfamily end | 95.21 | |
| cd04785 | 126 | HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding do | 95.2 | |
| TIGR02044 | 127 | CueR Cu(I)-responsive transcriptional regulator. T | 95.2 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 95.2 | |
| cd04770 | 123 | HTH_HMRTR Helix-Turn-Helix DNA binding domain of H | 95.2 | |
| cd04790 | 172 | HTH_Cfa-like_unk Helix-Turn-Helix DNA binding doma | 95.18 | |
| TIGR02044 | 127 | CueR Cu(I)-responsive transcriptional regulator. T | 95.18 | |
| PRK00430 | 95 | fis global DNA-binding transcriptional dual regula | 95.17 | |
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 95.16 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 95.14 | |
| cd04783 | 126 | HTH_MerR1 Helix-Turn-Helix DNA binding domain of t | 95.13 | |
| PF07750 | 162 | GcrA: GcrA cell cycle regulator; InterPro: IPR0116 | 95.11 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 95.1 | |
| cd04766 | 91 | HTH_HspR Helix-Turn-Helix DNA binding domain of th | 95.08 | |
| PHA00675 | 78 | hypothetical protein | 95.07 | |
| cd04786 | 131 | HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding dom | 95.06 | |
| cd04769 | 116 | HTH_MerR2 Helix-Turn-Helix DNA binding domain of M | 95.05 | |
| PRK09514 | 140 | zntR zinc-responsive transcriptional regulator; Pr | 95.05 | |
| cd01111 | 107 | HTH_MerD Helix-Turn-Helix DNA binding domain of th | 95.03 | |
| PRK09393 | 322 | ftrA transcriptional activator FtrA; Provisional | 95.03 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 95.01 | |
| PRK09514 | 140 | zntR zinc-responsive transcriptional regulator; Pr | 95.0 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 94.99 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 94.99 | |
| PRK00118 | 104 | putative DNA-binding protein; Validated | 94.98 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 94.92 | |
| PF00292 | 125 | PAX: 'Paired box' domain; InterPro: IPR001523 The | 94.91 | |
| PHA00542 | 82 | putative Cro-like protein | 94.91 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 94.89 | |
| cd04767 | 120 | HTH_HspR-like_MBC Helix-Turn-Helix DNA binding dom | 94.88 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 94.87 | |
| cd04784 | 127 | HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain | 94.86 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 94.85 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 94.84 | |
| TIGR02047 | 127 | CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional | 94.84 | |
| PF12833 | 81 | HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_ | 94.83 | |
| cd06171 | 55 | Sigma70_r4 Sigma70, region (SR) 4 refers to the mo | 94.83 | |
| COG1342 | 99 | Predicted DNA-binding proteins [General function p | 94.83 | |
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 94.82 | |
| TIGR02047 | 127 | CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional | 94.77 | |
| PHA02591 | 83 | hypothetical protein; Provisional | 94.77 | |
| PRK15043 | 243 | transcriptional regulator MirA; Provisional | 94.75 | |
| COG0789 | 124 | SoxR Predicted transcriptional regulators [Transcr | 94.72 | |
| PRK15121 | 289 | right oriC-binding transcriptional activator; Prov | 94.69 | |
| cd04766 | 91 | HTH_HspR Helix-Turn-Helix DNA binding domain of th | 94.69 | |
| TIGR02051 | 124 | MerR Hg(II)-responsive transcriptional regulator. | 94.68 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 94.66 | |
| PF02001 | 106 | DUF134: Protein of unknown function DUF134; InterP | 94.64 | |
| COG3284 | 606 | AcoR Transcriptional activator of acetoin/glycerol | 94.64 | |
| cd04786 | 131 | HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding dom | 94.63 | |
| TIGR02844 | 80 | spore_III_D sporulation transcriptional regulator | 94.59 | |
| TIGR01950 | 142 | SoxR redox-sensitive transcriptional activator Sox | 94.59 | |
| COG2826 | 318 | Tra8 Transposase and inactivated derivatives, IS30 | 94.56 | |
| cd04776 | 118 | HTH_GnyR Helix-Turn-Helix DNA binding domain of th | 94.56 | |
| PF13022 | 142 | HTH_Tnp_1_2: Helix-turn-helix of insertion element | 94.51 | |
| COG2973 | 103 | TrpR Trp operon repressor [Transcription] | 94.51 | |
| cd04787 | 133 | HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain | 94.51 | |
| PF01371 | 87 | Trp_repressor: Trp repressor protein; InterPro: IP | 94.47 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 94.47 | |
| PF13613 | 53 | HTH_Tnp_4: Helix-turn-helix of DDE superfamily end | 94.46 | |
| PRK09940 | 253 | transcriptional regulator YdeO; Provisional | 94.46 | |
| PRK00118 | 104 | putative DNA-binding protein; Validated | 94.42 | |
| PF07750 | 162 | GcrA: GcrA cell cycle regulator; InterPro: IPR0116 | 94.41 | |
| cd04784 | 127 | HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain | 94.41 | |
| cd04776 | 118 | HTH_GnyR Helix-Turn-Helix DNA binding domain of th | 94.37 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 94.34 | |
| cd04779 | 134 | HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding dom | 94.32 | |
| PRK15002 | 154 | redox-sensitivie transcriptional activator SoxR; P | 94.3 | |
| COG5484 | 279 | Uncharacterized conserved protein [Function unknow | 94.26 | |
| TIGR02054 | 120 | MerD mercuric resistence transcriptional repressor | 94.25 | |
| cd04779 | 134 | HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding dom | 94.23 | |
| PF03683 | 76 | UPF0175: Uncharacterised protein family (UPF0175); | 94.23 | |
| PRK10227 | 135 | DNA-binding transcriptional regulator CueR; Provis | 94.22 | |
| TIGR03879 | 73 | near_KaiC_dom probable regulatory domain. This mod | 94.18 | |
| PF09824 | 160 | ArsR: ArsR transcriptional regulator; InterPro: IP | 94.17 | |
| TIGR01950 | 142 | SoxR redox-sensitive transcriptional activator Sox | 94.14 | |
| TIGR02054 | 120 | MerD mercuric resistence transcriptional repressor | 94.14 | |
| PF06627 | 90 | DUF1153: Protein of unknown function (DUF1153); In | 94.14 | |
| PHA02943 | 165 | hypothetical protein; Provisional | 94.13 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 94.13 | |
| PHA00542 | 82 | putative Cro-like protein | 94.11 | |
| cd04778 | 219 | HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding dom | 94.09 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 94.07 | |
| PRK11179 | 153 | DNA-binding transcriptional regulator AsnC; Provis | 94.05 | |
| PF04297 | 101 | UPF0122: Putative helix-turn-helix protein, YlxM / | 94.02 | |
| cd04787 | 133 | HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain | 93.99 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 93.95 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 93.88 | |
| PF03683 | 76 | UPF0175: Uncharacterised protein family (UPF0175); | 93.87 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 93.87 | |
| TIGR03734 | 554 | PRTRC_parB PRTRC system ParB family protein. A nov | 93.83 | |
| PRK01381 | 99 | Trp operon repressor; Provisional | 93.75 | |
| PF08822 | 165 | DUF1804: Protein of unknown function (DUF1804); In | 93.74 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 93.73 | |
| COG0789 | 124 | SoxR Predicted transcriptional regulators [Transcr | 93.71 | |
| PRK10227 | 135 | DNA-binding transcriptional regulator CueR; Provis | 93.68 | |
| PF01381 | 55 | HTH_3: Helix-turn-helix; InterPro: IPR001387 This | 93.67 | |
| PRK15002 | 154 | redox-sensitivie transcriptional activator SoxR; P | 93.53 | |
| PF00196 | 58 | GerE: Bacterial regulatory proteins, luxR family; | 93.49 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 93.47 | |
| PF13309 | 64 | HTH_22: HTH domain | 93.45 | |
| PF04297 | 101 | UPF0122: Putative helix-turn-helix protein, YlxM / | 93.45 | |
| cd04777 | 107 | HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding dom | 93.43 | |
| PF03333 | 91 | PapB: Adhesin biosynthesis transcription regulator | 93.39 | |
| TIGR02844 | 80 | spore_III_D sporulation transcriptional regulator | 93.39 | |
| TIGR02051 | 124 | MerR Hg(II)-responsive transcriptional regulator. | 93.38 | |
| PF13556 | 59 | HTH_30: PucR C-terminal helix-turn-helix domain; P | 93.3 | |
| PF14493 | 91 | HTH_40: Helix-turn-helix domain | 93.29 | |
| PF01371 | 87 | Trp_repressor: Trp repressor protein; InterPro: IP | 93.26 | |
| PRK15435 | 353 | bifunctional DNA-binding transcriptional dual regu | 93.23 | |
| TIGR03879 | 73 | near_KaiC_dom probable regulatory domain. This mod | 93.2 | |
| COG2207 | 127 | AraC AraC-type DNA-binding domain-containing prote | 93.19 | |
| PRK15044 | 295 | transcriptional regulator SirC; Provisional | 93.19 | |
| PF01381 | 55 | HTH_3: Helix-turn-helix; InterPro: IPR001387 This | 93.16 | |
| PF06163 | 127 | DUF977: Bacterial protein of unknown function (DUF | 93.04 | |
| PRK15186 | 291 | AraC family transcriptional regulator; Provisional | 93.04 | |
| smart00420 | 53 | HTH_DEOR helix_turn_helix, Deoxyribose operon repr | 92.98 | |
| PHA01976 | 67 | helix-turn-helix protein | 92.97 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 92.97 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 92.93 | |
| PRK11169 | 164 | leucine-responsive transcriptional regulator; Prov | 92.9 | |
| COG3311 | 70 | AlpA Predicted transcriptional regulator [Transcri | 92.89 | |
| PRK13752 | 144 | putative transcriptional regulator MerR; Provision | 92.84 | |
| COG3677 | 129 | Transposase and inactivated derivatives [DNA repli | 92.79 | |
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 92.78 | |
| PRK13749 | 121 | transcriptional regulator MerD; Provisional | 92.75 | |
| COG5484 | 279 | Uncharacterized conserved protein [Function unknow | 92.74 | |
| cd04777 | 107 | HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding dom | 92.58 | |
| PF14493 | 91 | HTH_40: Helix-turn-helix domain | 92.53 | |
| PF13556 | 59 | HTH_30: PucR C-terminal helix-turn-helix domain; P | 92.52 | |
| PF00356 | 46 | LacI: Bacterial regulatory proteins, lacI family; | 92.51 | |
| PF08822 | 165 | DUF1804: Protein of unknown function (DUF1804); In | 92.49 | |
| PRK13752 | 144 | putative transcriptional regulator MerR; Provision | 92.48 | |
| cd06571 | 90 | Bac_DnaA_C C-terminal domain of bacterial DnaA pro | 92.47 | |
| PF14549 | 60 | P22_Cro: DNA-binding transcriptional regulator Cro | 92.46 | |
| PF13443 | 63 | HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3 | 92.43 | |
| PRK15185 | 309 | transcriptional regulator HilD; Provisional | 92.42 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 92.39 | |
| PRK09726 | 88 | antitoxin HipB; Provisional | 92.39 | |
| cd04772 | 99 | HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding d | 92.34 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 92.29 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 92.29 | |
| PF01418 | 77 | HTH_6: Helix-turn-helix domain, rpiR family; Inter | 92.29 | |
| PRK06759 | 154 | RNA polymerase factor sigma-70; Validated | 92.24 | |
| PRK09863 | 584 | putative frv operon regulatory protein; Provisiona | 92.16 | |
| PRK15435 | 353 | bifunctional DNA-binding transcriptional dual regu | 92.11 | |
| PF03374 | 111 | ANT: Phage antirepressor protein KilAC domain; Int | 92.11 | |
| PF13443 | 63 | HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3 | 92.1 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 92.09 | |
| PF04936 | 186 | DUF658: Protein of unknown function (DUF658); Inte | 92.06 | |
| PRK09685 | 302 | DNA-binding transcriptional activator FeaR; Provis | 92.01 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 92.01 | |
| TIGR02989 | 159 | Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop | 91.99 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 91.92 | |
| PF12844 | 64 | HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_ | 91.87 | |
| PRK12537 | 182 | RNA polymerase sigma factor; Provisional | 91.84 | |
| PF05930 | 51 | Phage_AlpA: Prophage CP4-57 regulatory protein (Al | 91.82 | |
| PF07900 | 220 | DUF1670: Protein of unknown function (DUF1670); In | 91.8 | |
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 91.79 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 91.79 | |
| PRK09940 | 253 | transcriptional regulator YdeO; Provisional | 91.77 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 91.77 | |
| TIGR00122 | 69 | birA_repr_reg BirA biotin operon repressor domain. | 91.75 | |
| PRK09393 | 322 | ftrA transcriptional activator FtrA; Provisional | 91.74 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 91.74 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 91.74 | |
| PRK09652 | 182 | RNA polymerase sigma factor RpoE; Provisional | 91.7 | |
| TIGR02937 | 158 | sigma70-ECF RNA polymerase sigma factor, sigma-70 | 91.56 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 91.52 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 91.52 | |
| PF12833 | 81 | HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_ | 91.51 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 91.51 | |
| PRK01905 | 77 | DNA-binding protein Fis; Provisional | 91.37 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 91.32 | |
| COG2207 | 127 | AraC AraC-type DNA-binding domain-containing prote | 91.32 | |
| cd00090 | 78 | HTH_ARSR Arsenical Resistance Operon Repressor and | 91.28 | |
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 91.26 | |
| COG2944 | 104 | Predicted transcriptional regulator [Transcription | 91.26 | |
| PRK13749 | 121 | transcriptional regulator MerD; Provisional | 91.19 | |
| TIGR00122 | 69 | birA_repr_reg BirA biotin operon repressor domain. | 91.18 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 91.16 | |
| PF00126 | 60 | HTH_1: Bacterial regulatory helix-turn-helix prote | 91.13 | |
| PRK10072 | 96 | putative transcriptional regulator; Provisional | 91.12 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 91.1 | |
| PRK09978 | 274 | DNA-binding transcriptional regulator GadX; Provis | 91.08 | |
| cd04772 | 99 | HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding d | 90.95 | |
| PF05344 | 65 | DUF746: Domain of Unknown Function (DUF746); Inter | 90.77 | |
| cd04778 | 219 | HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding dom | 90.74 | |
| PRK09642 | 160 | RNA polymerase sigma factor SigW; Reviewed | 90.67 | |
| PRK15340 | 216 | transcriptional regulator InvF; Provisional | 90.66 | |
| COG2901 | 98 | Fis Factor for inversion stimulation Fis, transcri | 90.65 | |
| PF12298 | 172 | Bot1p: Eukaryotic mitochondrial regulator protein | 90.63 | |
| PRK06759 | 154 | RNA polymerase factor sigma-70; Validated | 90.61 | |
| PRK15418 | 318 | transcriptional regulator LsrR; Provisional | 90.61 | |
| cd00090 | 78 | HTH_ARSR Arsenical Resistance Operon Repressor and | 90.55 | |
| PRK12525 | 168 | RNA polymerase sigma factor; Provisional | 90.53 | |
| PRK10130 | 350 | transcriptional regulator EutR; Provisional | 90.5 | |
| COG2973 | 103 | TrpR Trp operon repressor [Transcription] | 90.49 | |
| COG2739 | 105 | Uncharacterized protein conserved in bacteria [Fun | 90.44 | |
| TIGR02999 | 183 | Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f | 90.43 | |
| PF13022 | 142 | HTH_Tnp_1_2: Helix-turn-helix of insertion element | 90.4 | |
| PRK06288 | 268 | RNA polymerase sigma factor WhiG; Reviewed | 90.37 | |
| PRK12547 | 164 | RNA polymerase sigma factor; Provisional | 90.37 | |
| PRK10072 | 96 | putative transcriptional regulator; Provisional | 90.36 | |
| TIGR02989 | 159 | Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop | 90.25 | |
| PRK09642 | 160 | RNA polymerase sigma factor SigW; Reviewed | 90.22 | |
| PRK11924 | 179 | RNA polymerase sigma factor; Provisional | 90.21 | |
| PHA00738 | 108 | putative HTH transcription regulator | 90.1 | |
| PRK09639 | 166 | RNA polymerase sigma factor SigX; Provisional | 90.1 | |
| PRK06986 | 236 | fliA flagellar biosynthesis sigma factor; Validate | 90.1 | |
| TIGR02952 | 170 | Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 | 90.07 | |
| COG2739 | 105 | Uncharacterized protein conserved in bacteria [Fun | 90.07 | |
| PRK09646 | 194 | RNA polymerase sigma factor SigK; Reviewed | 90.05 | |
| TIGR02366 | 176 | DHAK_reg probable dihydroxyacetone kinase regulato | 90.04 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 89.97 | |
| PRK06474 | 178 | hypothetical protein; Provisional | 89.87 | |
| TIGR02985 | 161 | Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba | 89.87 | |
| PF00376 | 38 | MerR: MerR family regulatory protein; InterPro: IP | 89.86 | |
| TIGR03070 | 58 | couple_hipB transcriptional regulator, y4mF family | 89.8 | |
| PF12759 | 46 | HTH_Tnp_IS1: InsA C-terminal domain; InterPro: IPR | 89.8 | |
| PF05930 | 51 | Phage_AlpA: Prophage CP4-57 regulatory protein (Al | 89.79 | |
| PF06627 | 90 | DUF1153: Protein of unknown function (DUF1153); In | 89.79 | |
| PRK12520 | 191 | RNA polymerase sigma factor; Provisional | 89.77 | |
| PRK09047 | 161 | RNA polymerase factor sigma-70; Validated | 89.76 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 89.75 | |
| PHA02591 | 83 | hypothetical protein; Provisional | 89.75 | |
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 89.73 | |
| PRK09644 | 165 | RNA polymerase sigma factor SigM; Provisional | 89.72 | |
| TIGR02607 | 78 | antidote_HigA addiction module antidote protein, H | 89.69 | |
| PRK13919 | 186 | putative RNA polymerase sigma E protein; Provision | 89.68 | |
| PRK12528 | 161 | RNA polymerase sigma factor; Provisional | 89.68 | |
| PF04703 | 62 | FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. | 89.62 | |
| PRK09415 | 179 | RNA polymerase factor sigma C; Reviewed | 89.61 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 89.57 | |
| PF00196 | 58 | GerE: Bacterial regulatory proteins, luxR family; | 89.48 | |
| TIGR02983 | 162 | SigE-fam_strep RNA polymerase sigma-70 factor, sig | 89.46 | |
| PF07638 | 185 | Sigma70_ECF: ECF sigma factor | 89.46 | |
| PRK12543 | 179 | RNA polymerase sigma factor; Provisional | 89.41 | |
| PRK12540 | 182 | RNA polymerase sigma factor; Provisional | 89.39 | |
| PRK12532 | 195 | RNA polymerase sigma factor; Provisional | 89.37 | |
| TIGR00637 | 99 | ModE_repress ModE molybdate transport repressor do | 89.36 | |
| PRK10141 | 117 | DNA-binding transcriptional repressor ArsR; Provis | 89.36 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 89.36 | |
| PRK15121 | 289 | right oriC-binding transcriptional activator; Prov | 89.36 | |
| PRK12539 | 184 | RNA polymerase sigma factor; Provisional | 89.27 | |
| TIGR03001 | 244 | Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxoco | 89.27 | |
| smart00420 | 53 | HTH_DEOR helix_turn_helix, Deoxyribose operon repr | 89.25 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 89.24 | |
| PRK05602 | 186 | RNA polymerase sigma factor; Reviewed | 89.23 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 89.22 | |
| PRK12527 | 159 | RNA polymerase sigma factor; Reviewed | 89.21 | |
| PRK11179 | 153 | DNA-binding transcriptional regulator AsnC; Provis | 89.21 | |
| PF01047 | 59 | MarR: MarR family; InterPro: IPR000835 The MarR-ty | 89.21 | |
| PRK12514 | 179 | RNA polymerase sigma factor; Provisional | 89.19 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 89.16 | |
| PRK12511 | 182 | RNA polymerase sigma factor; Provisional | 89.15 | |
| PRK12528 | 161 | RNA polymerase sigma factor; Provisional | 89.11 | |
| PF02042 | 52 | RWP-RK: RWP-RK domain; InterPro: IPR003035 This do | 89.08 | |
| COG1595 | 182 | RpoE DNA-directed RNA polymerase specialized sigma | 89.08 | |
| COG1710 | 139 | Uncharacterized protein conserved in archaea [Func | 89.06 | |
| PRK07037 | 163 | extracytoplasmic-function sigma-70 factor; Validat | 88.98 | |
| COG3284 | 606 | AcoR Transcriptional activator of acetoin/glycerol | 88.93 | |
| PRK12536 | 181 | RNA polymerase sigma factor; Provisional | 88.9 | |
| COG3877 | 122 | Uncharacterized protein conserved in bacteria [Fun | 88.86 | |
| PF14549 | 60 | P22_Cro: DNA-binding transcriptional regulator Cro | 88.84 | |
| PF00440 | 47 | TetR_N: Bacterial regulatory proteins, tetR family | 88.83 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 88.82 | |
| PRK12529 | 178 | RNA polymerase sigma factor; Provisional | 88.82 | |
| PRK15340 | 216 | transcriptional regulator InvF; Provisional | 88.77 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 88.77 | |
| PRK12530 | 189 | RNA polymerase sigma factor; Provisional | 88.74 | |
| TIGR02943 | 188 | Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 | 88.74 | |
| TIGR02937 | 158 | sigma70-ECF RNA polymerase sigma factor, sigma-70 | 88.71 | |
| PRK11169 | 164 | leucine-responsive transcriptional regulator; Prov | 88.69 | |
| PRK12519 | 194 | RNA polymerase sigma factor; Provisional | 88.65 | |
| PRK12529 | 178 | RNA polymerase sigma factor; Provisional | 88.62 | |
| smart00344 | 108 | HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto | 88.61 | |
| PRK09644 | 165 | RNA polymerase sigma factor SigM; Provisional | 88.59 | |
| PRK12516 | 187 | RNA polymerase sigma factor; Provisional | 88.56 | |
| PRK09637 | 181 | RNA polymerase sigma factor SigZ; Provisional | 88.56 | |
| PF00356 | 46 | LacI: Bacterial regulatory proteins, lacI family; | 88.54 | |
| TIGR02954 | 169 | Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 | 88.53 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 88.51 | |
| TIGR02999 | 183 | Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f | 88.51 | |
| PRK09648 | 189 | RNA polymerase sigma factor SigD; Reviewed | 88.47 | |
| PRK12514 | 179 | RNA polymerase sigma factor; Provisional | 88.47 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 88.41 | |
| PRK12541 | 161 | RNA polymerase sigma factor; Provisional | 88.4 | |
| TIGR02959 | 170 | SigZ RNA polymerase sigma factor, SigZ family. Thi | 88.36 | |
| PRK00430 | 95 | fis global DNA-binding transcriptional dual regula | 88.34 | |
| COG3413 | 215 | Predicted DNA binding protein [General function pr | 88.32 | |
| PRK12533 | 216 | RNA polymerase sigma factor; Provisional | 88.29 | |
| COG1961 | 222 | PinR Site-specific recombinases, DNA invertase Pin | 88.28 | |
| PRK09047 | 161 | RNA polymerase factor sigma-70; Validated | 88.26 | |
| PRK12547 | 164 | RNA polymerase sigma factor; Provisional | 88.22 | |
| PRK12519 | 194 | RNA polymerase sigma factor; Provisional | 88.19 | |
| PRK12523 | 172 | RNA polymerase sigma factor; Reviewed | 88.18 | |
| PRK11050 | 152 | manganese transport regulator MntR; Provisional | 88.16 | |
| PRK12542 | 185 | RNA polymerase sigma factor; Provisional | 88.13 | |
| PRK12524 | 196 | RNA polymerase sigma factor; Provisional | 88.05 | |
| COG1522 | 154 | Lrp Transcriptional regulators [Transcription] | 88.04 | |
| PRK12526 | 206 | RNA polymerase sigma factor; Provisional | 87.98 | |
| PF12298 | 172 | Bot1p: Eukaryotic mitochondrial regulator protein | 87.98 | |
| PRK12537 | 182 | RNA polymerase sigma factor; Provisional | 87.98 | |
| PRK09648 | 189 | RNA polymerase sigma factor SigD; Reviewed | 87.96 | |
| PRK12530 | 189 | RNA polymerase sigma factor; Provisional | 87.88 | |
| PRK09645 | 173 | RNA polymerase sigma factor SigL; Provisional | 87.87 | |
| COG1710 | 139 | Uncharacterized protein conserved in archaea [Func | 87.85 | |
| PRK12527 | 159 | RNA polymerase sigma factor; Reviewed | 87.85 | |
| TIGR02954 | 169 | Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 | 87.8 | |
| TIGR02983 | 162 | SigE-fam_strep RNA polymerase sigma-70 factor, sig | 87.8 | |
| PRK08301 | 234 | sporulation sigma factor SigE; Reviewed | 87.67 | |
| PF00126 | 60 | HTH_1: Bacterial regulatory helix-turn-helix prote | 87.63 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 87.62 | |
| TIGR02947 | 193 | SigH_actino RNA polymerase sigma-70 factor, TIGR02 | 87.57 | |
| PF11198 | 180 | DUF2857: Protein of unknown function (DUF2857); In | 87.54 | |
| PRK12516 | 187 | RNA polymerase sigma factor; Provisional | 87.53 | |
| PRK10130 | 350 | transcriptional regulator EutR; Provisional | 87.51 | |
| PRK09685 | 302 | DNA-binding transcriptional activator FeaR; Provis | 87.44 | |
| PRK12522 | 173 | RNA polymerase sigma factor; Provisional | 87.43 | |
| COG1595 | 182 | RpoE DNA-directed RNA polymerase specialized sigma | 87.38 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 87.34 | |
| PRK03975 | 141 | tfx putative transcriptional regulator; Provisiona | 87.34 | |
| TIGR02980 | 227 | SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G | 87.33 | |
| PF07638 | 185 | Sigma70_ECF: ECF sigma factor | 87.33 | |
| PRK10783 | 456 | mltD membrane-bound lytic murein transglycosylase | 87.3 | |
| PRK05602 | 186 | RNA polymerase sigma factor; Reviewed | 87.29 | |
| PRK12542 | 185 | RNA polymerase sigma factor; Provisional | 87.29 | |
| PRK12512 | 184 | RNA polymerase sigma factor; Provisional | 87.27 | |
| PRK06811 | 189 | RNA polymerase factor sigma-70; Validated | 87.26 | |
| PF04703 | 62 | FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. | 87.24 | |
| PRK12540 | 182 | RNA polymerase sigma factor; Provisional | 87.22 | |
| PRK10100 | 216 | DNA-binding transcriptional regulator CsgD; Provis | 87.18 | |
| cd00093 | 58 | HTH_XRE Helix-turn-helix XRE-family like proteins. | 87.17 | |
| smart00345 | 60 | HTH_GNTR helix_turn_helix gluconate operon transcr | 87.13 | |
| PRK12525 | 168 | RNA polymerase sigma factor; Provisional | 87.12 | |
| TIGR00721 | 137 | tfx DNA-binding protein, Tfx family. Tfx from Meth | 87.1 |
| >PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
Probab=99.20 E-value=2.2e-10 Score=90.02 Aligned_cols=90 Identities=18% Similarity=0.378 Sum_probs=69.2
Q ss_pred CCCHHHHHHHHHHHHcCCCCHHHHHHHhCCChHHHHHHHHHh--CCcccCCCCCCCCCCCHHHHHHHHHHHHhCCCcHHH
Q psy17316 118 SWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKE--GIRLAQPFNASPTAWKPEDLEIALEGIRSGQTTVQR 195 (229)
Q Consensus 118 kYs~e~k~~AV~~~~~g~~S~~~~a~k~gIp~sTL~~~ik~~--g~k~~~~~~~~~r~~t~e~r~eaV~~~~~~~~s~~e 195 (229)
.||.|++..+|..+..|+ |..+||..|+|+.+|+++|+++. |-....|. ..++.+.++..+.|+. +.+.++.|
T Consensus 2 aYS~DlR~rVl~~~~~g~-s~~eaa~~F~VS~~Tv~~W~k~~~~G~~~~k~r--~~~Kid~~~L~~~v~~--~pd~tl~E 76 (119)
T PF01710_consen 2 AYSLDLRQRVLAYIEKGK-SIREAAKRFGVSRNTVYRWLKRKETGDLEPKPR--GRKKIDRDELKALVEE--NPDATLRE 76 (119)
T ss_pred CCCHHHHHHHHHHHHccc-hHHHHHHHhCcHHHHHHHHHHhccccccccccc--ccccccHHHHHHHHHH--CCCcCHHH
Confidence 699999999999888877 99999999999999999999843 32211121 1115554444444443 36688999
Q ss_pred HHHHhCCChHHHHHHHH
Q psy17316 196 ASAEYGIPSGTLYGRCK 212 (229)
Q Consensus 196 AA~~fgVp~~tv~~~vk 212 (229)
.|.+|||+.+||+..++
T Consensus 77 la~~l~Vs~~ti~~~Lk 93 (119)
T PF01710_consen 77 LAERLGVSPSTIWRALK 93 (119)
T ss_pred HHHHcCCCHHHHHHHHH
Confidence 99999999999999998
|
This entry includes insertion sequences from Synechocystis sp. (strain PCC 6803) three of which are characterised as homologous to bacterial IS5- and IS4- and to several members of the IS630-Tc1-mariner superfamily []. More information about these proteins can be found at Protein of the Month: Transposase []. |
| >PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] | Back alignment and domain information |
|---|
| >COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] | Back alignment and domain information |
|---|
| >cd00131 PAX Paired Box domain | Back alignment and domain information |
|---|
| >smart00351 PAX Paired Box domain | Back alignment and domain information |
|---|
| >COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13551 HTH_29: Winged helix-turn helix | Back alignment and domain information |
|---|
| >PF13551 HTH_29: Winged helix-turn helix | Back alignment and domain information |
|---|
| >cd00131 PAX Paired Box domain | Back alignment and domain information |
|---|
| >PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >smart00351 PAX Paired Box domain | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A | Back alignment and domain information |
|---|
| >PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C | Back alignment and domain information |
|---|
| >cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA | Back alignment and domain information |
|---|
| >PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] | Back alignment and domain information |
|---|
| >PF09607 BrkDBD: Brinker DNA-binding domain; InterPro: IPR018586 This DNA-binding domain is the first approx | Back alignment and domain information |
|---|
| >cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA | Back alignment and domain information |
|---|
| >PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A | Back alignment and domain information |
|---|
| >PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] | Back alignment and domain information |
|---|
| >cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella | Back alignment and domain information |
|---|
| >cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators | Back alignment and domain information |
|---|
| >PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 | Back alignment and domain information |
|---|
| >cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella | Back alignment and domain information |
|---|
| >PF13411 MerR_1: MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B | Back alignment and domain information |
|---|
| >PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 | Back alignment and domain information |
|---|
| >cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators | Back alignment and domain information |
|---|
| >PRK13413 mpi multiple promoter invertase; Provisional | Back alignment and domain information |
|---|
| >PF13411 MerR_1: MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B | Back alignment and domain information |
|---|
| >cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators | Back alignment and domain information |
|---|
| >PF13565 HTH_32: Homeodomain-like domain | Back alignment and domain information |
|---|
| >cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators | Back alignment and domain information |
|---|
| >cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins | Back alignment and domain information |
|---|
| >smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein | Back alignment and domain information |
|---|
| >PHA02535 P terminase ATPase subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4565|consensus | Back alignment and domain information |
|---|
| >PF09607 BrkDBD: Brinker DNA-binding domain; InterPro: IPR018586 This DNA-binding domain is the first approx | Back alignment and domain information |
|---|
| >PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] | Back alignment and domain information |
|---|
| >PRK11511 DNA-binding transcriptional activator MarA; Provisional | Back alignment and domain information |
|---|
| >PRK10219 DNA-binding transcriptional regulator SoxS; Provisional | Back alignment and domain information |
|---|
| >PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >smart00422 HTH_MERR helix_turn_helix, mercury resistance | Back alignment and domain information |
|---|
| >PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D | Back alignment and domain information |
|---|
| >cd04788 HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain of the transcription regulators NolA and AlbR | Back alignment and domain information |
|---|
| >PHA00675 hypothetical protein | Back alignment and domain information |
|---|
| >smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein | Back alignment and domain information |
|---|
| >PHA02535 P terminase ATPase subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4565|consensus | Back alignment and domain information |
|---|
| >cd01105 HTH_GlnR-like Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators | Back alignment and domain information |
|---|
| >cd04788 HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain of the transcription regulators NolA and AlbR | Back alignment and domain information |
|---|
| >cd01106 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA | Back alignment and domain information |
|---|
| >smart00422 HTH_MERR helix_turn_helix, mercury resistance | Back alignment and domain information |
|---|
| >cd01105 HTH_GlnR-like Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators | Back alignment and domain information |
|---|
| >PF00292 PAX: 'Paired box' domain; InterPro: IPR001523 The paired box is a conserved 124 amino acid N-terminal domain of unknown function that usually, but not always, precedes a homeobox domain (see IPR001356 from INTERPRO) [, ] | Back alignment and domain information |
|---|
| >cd04765 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators | Back alignment and domain information |
|---|
| >cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >smart00421 HTH_LUXR helix_turn_helix, Lux Regulon | Back alignment and domain information |
|---|
| >cd04765 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators | Back alignment and domain information |
|---|
| >PRK13182 racA polar chromosome segregation protein; Reviewed | Back alignment and domain information |
|---|
| >PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes | Back alignment and domain information |
|---|
| >TIGR02531 yecD_yerC TrpR-related protein YerC/YecD | Back alignment and domain information |
|---|
| >TIGR01764 excise DNA binding domain, excisionase family | Back alignment and domain information |
|---|
| >smart00421 HTH_LUXR helix_turn_helix, Lux Regulon | Back alignment and domain information |
|---|
| >COG2826 Tra8 Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] | Back alignment and domain information |
|---|
| >cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators | Back alignment and domain information |
|---|
| >PRK11511 DNA-binding transcriptional activator MarA; Provisional | Back alignment and domain information |
|---|
| >PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 | Back alignment and domain information |
|---|
| >PF02042 RWP-RK: RWP-RK domain; InterPro: IPR003035 This domain is named RWP-RK after a conserved motif at the C terminus of the domain | Back alignment and domain information |
|---|
| >PRK04217 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04782 HTH_BltR Helix-Turn-Helix DNA binding domain of the BltR transcription regulator | Back alignment and domain information |
|---|
| >PF13565 HTH_32: Homeodomain-like domain | Back alignment and domain information |
|---|
| >cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators | Back alignment and domain information |
|---|
| >cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators | Back alignment and domain information |
|---|
| >COG1342 Predicted DNA-binding proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd01106 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA | Back alignment and domain information |
|---|
| >PRK13413 mpi multiple promoter invertase; Provisional | Back alignment and domain information |
|---|
| >cd01109 HTH_YyaN Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB | Back alignment and domain information |
|---|
| >cd01282 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >TIGR02531 yecD_yerC TrpR-related protein YerC/YecD | Back alignment and domain information |
|---|
| >PF12728 HTH_17: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes | Back alignment and domain information |
|---|
| >cd00592 HTH_MerR-like Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >cd01110 HTH_SoxR Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator | Back alignment and domain information |
|---|
| >PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 | Back alignment and domain information |
|---|
| >PF13309 HTH_22: HTH domain | Back alignment and domain information |
|---|
| >cd01109 HTH_YyaN Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >cd01282 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PRK15044 transcriptional regulator SirC; Provisional | Back alignment and domain information |
|---|
| >PF07900 DUF1670: Protein of unknown function (DUF1670); InterPro: IPR012872 The hypothetical eukaryotic proteins found in this family are of unknown function | Back alignment and domain information |
|---|
| >PRK15186 AraC family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >cd00592 HTH_MerR-like Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators | Back alignment and domain information |
|---|
| >cd01110 HTH_SoxR Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator | Back alignment and domain information |
|---|
| >cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators | Back alignment and domain information |
|---|
| >cd01107 HTH_BmrR Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator | Back alignment and domain information |
|---|
| >cd04790 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding domain of putative Cfa-like transcription regulators | Back alignment and domain information |
|---|
| >TIGR01321 TrpR trp operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >PRK01905 DNA-binding protein Fis; Provisional | Back alignment and domain information |
|---|
| >PRK04217 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >cd01107 HTH_BmrR Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator | Back alignment and domain information |
|---|
| >TIGR01764 excise DNA binding domain, excisionase family | Back alignment and domain information |
|---|
| >PRK10219 DNA-binding transcriptional regulator SoxS; Provisional | Back alignment and domain information |
|---|
| >cd04785 HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding domain of the CadR- and PbrR-like transcription regulators | Back alignment and domain information |
|---|
| >cd04780 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >cd04774 HTH_YfmP Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator | Back alignment and domain information |
|---|
| >cd04782 HTH_BltR Helix-Turn-Helix DNA binding domain of the BltR transcription regulator | Back alignment and domain information |
|---|
| >cd04780 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) | Back alignment and domain information |
|---|
| >TIGR01321 TrpR trp operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >cd04789 HTH_Cfa Helix-Turn-Helix DNA binding domain of the Cfa transcription regulator | Back alignment and domain information |
|---|
| >cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >cd04773 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding domain of the regulatory protein TioE | Back alignment and domain information |
|---|
| >cd04789 HTH_Cfa Helix-Turn-Helix DNA binding domain of the Cfa transcription regulator | Back alignment and domain information |
|---|
| >cd04781 HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >cd04781 HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK09978 DNA-binding transcriptional regulator GadX; Provisional | Back alignment and domain information |
|---|
| >PRK01381 Trp operon repressor; Provisional | Back alignment and domain information |
|---|
| >PF02001 DUF134: Protein of unknown function DUF134; InterPro: IPR002852 The bacterial and archaeal proteins in this family have no known function | Back alignment and domain information |
|---|
| >cd01108 HTH_CueR Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators | Back alignment and domain information |
|---|
| >PRK15185 transcriptional regulator HilD; Provisional | Back alignment and domain information |
|---|
| >cd01279 HTH_HspR-like Helix-Turn-Helix DNA binding domain of HspR-like transcription regulators | Back alignment and domain information |
|---|
| >cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins | Back alignment and domain information |
|---|
| >cd01111 HTH_MerD Helix-Turn-Helix DNA binding domain of the MerD transcription regulator | Back alignment and domain information |
|---|
| >cd04770 HTH_HMRTR Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators | Back alignment and domain information |
|---|
| >cd04773 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding domain of the regulatory protein TioE | Back alignment and domain information |
|---|
| >cd04774 HTH_YfmP Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >cd04767 HTH_HspR-like_MBC Helix-Turn-Helix DNA binding domain of putative HspR-like transcription regulators | Back alignment and domain information |
|---|
| >TIGR02043 ZntR Zn(II)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >cd01108 HTH_CueR Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators | Back alignment and domain information |
|---|
| >PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >cd04783 HTH_MerR1 Helix-Turn-Helix DNA binding domain of the MerR1 transcription regulator | Back alignment and domain information |
|---|
| >cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins | Back alignment and domain information |
|---|
| >PF12728 HTH_17: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >cd04769 HTH_MerR2 Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators | Back alignment and domain information |
|---|
| >PRK13182 racA polar chromosome segregation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK15043 transcriptional regulator MirA; Provisional | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02043 ZntR Zn(II)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >cd01279 HTH_HspR-like Helix-Turn-Helix DNA binding domain of HspR-like transcription regulators | Back alignment and domain information |
|---|
| >PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease | Back alignment and domain information |
|---|
| >cd04785 HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding domain of the CadR- and PbrR-like transcription regulators | Back alignment and domain information |
|---|
| >TIGR02044 CueR Cu(I)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >cd04770 HTH_HMRTR Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators | Back alignment and domain information |
|---|
| >cd04790 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding domain of putative Cfa-like transcription regulators | Back alignment and domain information |
|---|
| >TIGR02044 CueR Cu(I)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >PRK00430 fis global DNA-binding transcriptional dual regulator Fis; Provisional | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >cd04783 HTH_MerR1 Helix-Turn-Helix DNA binding domain of the MerR1 transcription regulator | Back alignment and domain information |
|---|
| >PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator | Back alignment and domain information |
|---|
| >PHA00675 hypothetical protein | Back alignment and domain information |
|---|
| >cd04786 HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >cd04769 HTH_MerR2 Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators | Back alignment and domain information |
|---|
| >PRK09514 zntR zinc-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >cd01111 HTH_MerD Helix-Turn-Helix DNA binding domain of the MerD transcription regulator | Back alignment and domain information |
|---|
| >PRK09393 ftrA transcriptional activator FtrA; Provisional | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >PRK09514 zntR zinc-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PRK00118 putative DNA-binding protein; Validated | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >PF00292 PAX: 'Paired box' domain; InterPro: IPR001523 The paired box is a conserved 124 amino acid N-terminal domain of unknown function that usually, but not always, precedes a homeobox domain (see IPR001356 from INTERPRO) [, ] | Back alignment and domain information |
|---|
| >PHA00542 putative Cro-like protein | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >cd04767 HTH_HspR-like_MBC Helix-Turn-Helix DNA binding domain of putative HspR-like transcription regulators | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >cd04784 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain of the CadR and PbrR transcription regulators | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02047 CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >PF12833 HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_C 3OIO_A 1D5Y_B 3GBG_A 3OOU_A 1BL0_A 1XS9_A 3MN2_B 3MKL_B | Back alignment and domain information |
|---|
| >cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) | Back alignment and domain information |
|---|
| >COG1342 Predicted DNA-binding proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >TIGR02047 CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >PHA02591 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15043 transcriptional regulator MirA; Provisional | Back alignment and domain information |
|---|
| >COG0789 SoxR Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK15121 right oriC-binding transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator | Back alignment and domain information |
|---|
| >TIGR02051 MerR Hg(II)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PF02001 DUF134: Protein of unknown function DUF134; InterPro: IPR002852 The bacterial and archaeal proteins in this family have no known function | Back alignment and domain information |
|---|
| >COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] | Back alignment and domain information |
|---|
| >cd04786 HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID | Back alignment and domain information |
|---|
| >TIGR01950 SoxR redox-sensitive transcriptional activator SoxR | Back alignment and domain information |
|---|
| >COG2826 Tra8 Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd04776 HTH_GnyR Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR | Back alignment and domain information |
|---|
| >PF13022 HTH_Tnp_1_2: Helix-turn-helix of insertion element transposase; PDB: 2AO9_I | Back alignment and domain information |
|---|
| >COG2973 TrpR Trp operon repressor [Transcription] | Back alignment and domain information |
|---|
| >cd04787 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain of putative Heavy Metal Resistance transcription regulators | Back alignment and domain information |
|---|
| >PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease | Back alignment and domain information |
|---|
| >PRK09940 transcriptional regulator YdeO; Provisional | Back alignment and domain information |
|---|
| >PRK00118 putative DNA-binding protein; Validated | Back alignment and domain information |
|---|
| >PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator | Back alignment and domain information |
|---|
| >cd04784 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain of the CadR and PbrR transcription regulators | Back alignment and domain information |
|---|
| >cd04776 HTH_GnyR Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >cd04779 HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PRK15002 redox-sensitivie transcriptional activator SoxR; Provisional | Back alignment and domain information |
|---|
| >COG5484 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02054 MerD mercuric resistence transcriptional repressor protein MerD | Back alignment and domain information |
|---|
| >cd04779 HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF03683 UPF0175: Uncharacterised protein family (UPF0175); InterPro: IPR005368 This entry contains small proteins of unknown function | Back alignment and domain information |
|---|
| >PRK10227 DNA-binding transcriptional regulator CueR; Provisional | Back alignment and domain information |
|---|
| >TIGR03879 near_KaiC_dom probable regulatory domain | Back alignment and domain information |
|---|
| >PF09824 ArsR: ArsR transcriptional regulator; InterPro: IPR014517 Members of this family of archaeal proteins are conserved transcriptional regulators belonging to the ArsR family | Back alignment and domain information |
|---|
| >TIGR01950 SoxR redox-sensitive transcriptional activator SoxR | Back alignment and domain information |
|---|
| >TIGR02054 MerD mercuric resistence transcriptional repressor protein MerD | Back alignment and domain information |
|---|
| >PF06627 DUF1153: Protein of unknown function (DUF1153); InterPro: IPR009534 This family consists of several short, hypothetical bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PHA02943 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >PHA00542 putative Cro-like protein | Back alignment and domain information |
|---|
| >cd04778 HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >PRK11179 DNA-binding transcriptional regulator AsnC; Provisional | Back alignment and domain information |
|---|
| >PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd04787 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain of putative Heavy Metal Resistance transcription regulators | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >PF03683 UPF0175: Uncharacterised protein family (UPF0175); InterPro: IPR005368 This entry contains small proteins of unknown function | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >TIGR03734 PRTRC_parB PRTRC system ParB family protein | Back alignment and domain information |
|---|
| >PRK01381 Trp operon repressor; Provisional | Back alignment and domain information |
|---|
| >PF08822 DUF1804: Protein of unknown function (DUF1804); InterPro: IPR014926 This entry is represented by Bacteriophage D3112, Orf24 | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >COG0789 SoxR Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK10227 DNA-binding transcriptional regulator CueR; Provisional | Back alignment and domain information |
|---|
| >PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) | Back alignment and domain information |
|---|
| >PRK15002 redox-sensitivie transcriptional activator SoxR; Provisional | Back alignment and domain information |
|---|
| >PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF13309 HTH_22: HTH domain | Back alignment and domain information |
|---|
| >PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd04777 HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF03333 PapB: Adhesin biosynthesis transcription regulatory protein; InterPro: IPR004356 P pili, or fimbriae, are ~68A in diameter and 1 micron in length, the bulk of which is a fibre composed of the main structural protein PapA [] | Back alignment and domain information |
|---|
| >TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID | Back alignment and domain information |
|---|
| >TIGR02051 MerR Hg(II)-responsive transcriptional regulator | Back alignment and domain information |
|---|
| >PF13556 HTH_30: PucR C-terminal helix-turn-helix domain; PDB: 3ONQ_B | Back alignment and domain information |
|---|
| >PF14493 HTH_40: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression | Back alignment and domain information |
|---|
| >PRK15435 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03879 near_KaiC_dom probable regulatory domain | Back alignment and domain information |
|---|
| >COG2207 AraC AraC-type DNA-binding domain-containing proteins [Transcription] | Back alignment and domain information |
|---|
| >PRK15044 transcriptional regulator SirC; Provisional | Back alignment and domain information |
|---|
| >PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) | Back alignment and domain information |
|---|
| >PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK15186 AraC family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor | Back alignment and domain information |
|---|
| >PHA01976 helix-turn-helix protein | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK11169 leucine-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG3311 AlpA Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK13752 putative transcriptional regulator MerR; Provisional | Back alignment and domain information |
|---|
| >COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >PRK13749 transcriptional regulator MerD; Provisional | Back alignment and domain information |
|---|
| >COG5484 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd04777 HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF14493 HTH_40: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF13556 HTH_30: PucR C-terminal helix-turn-helix domain; PDB: 3ONQ_B | Back alignment and domain information |
|---|
| >PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF08822 DUF1804: Protein of unknown function (DUF1804); InterPro: IPR014926 This entry is represented by Bacteriophage D3112, Orf24 | Back alignment and domain information |
|---|
| >PRK13752 putative transcriptional regulator MerR; Provisional | Back alignment and domain information |
|---|
| >cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins | Back alignment and domain information |
|---|
| >PF14549 P22_Cro: DNA-binding transcriptional regulator Cro; PDB: 1RZS_A 3BD1_A 3QWS_A 2HIN_B | Back alignment and domain information |
|---|
| >PF13443 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A | Back alignment and domain information |
|---|
| >PRK15185 transcriptional regulator HilD; Provisional | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK09726 antitoxin HipB; Provisional | Back alignment and domain information |
|---|
| >cd04772 HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding domain of the regulatory protein TioE | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PF01418 HTH_6: Helix-turn-helix domain, rpiR family; InterPro: IPR000281 This domain contains a helix-turn-helix motif [] | Back alignment and domain information |
|---|
| >PRK06759 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK09863 putative frv operon regulatory protein; Provisional | Back alignment and domain information |
|---|
| >PRK15435 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF03374 ANT: Phage antirepressor protein KilAC domain; InterPro: IPR005039 This entry is represented by Bacteriophage P1, Ant1 C-terminal domain, which represents the processed Ant2 chain | Back alignment and domain information |
|---|
| >PF13443 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF04936 DUF658: Protein of unknown function (DUF658); InterPro: IPR007020 This entry is represented by Bacteriophage r1t, Orf18 | Back alignment and domain information |
|---|
| >PRK09685 DNA-binding transcriptional activator FeaR; Provisional | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >PF12844 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B | Back alignment and domain information |
|---|
| >PRK12537 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF05930 Phage_AlpA: Prophage CP4-57 regulatory protein (AlpA); InterPro: IPR010260 This entry is represents phage P4, Orf88 | Back alignment and domain information |
|---|
| >PF07900 DUF1670: Protein of unknown function (DUF1670); InterPro: IPR012872 The hypothetical eukaryotic proteins found in this family are of unknown function | Back alignment and domain information |
|---|
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK09940 transcriptional regulator YdeO; Provisional | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >TIGR00122 birA_repr_reg BirA biotin operon repressor domain | Back alignment and domain information |
|---|
| >PRK09393 ftrA transcriptional activator FtrA; Provisional | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >PRK09652 RNA polymerase sigma factor RpoE; Provisional | Back alignment and domain information |
|---|
| >TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >PF12833 HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_C 3OIO_A 1D5Y_B 3GBG_A 3OOU_A 1BL0_A 1XS9_A 3MN2_B 3MKL_B | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >PRK01905 DNA-binding protein Fis; Provisional | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >COG2207 AraC AraC-type DNA-binding domain-containing proteins [Transcription] | Back alignment and domain information |
|---|
| >cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >COG2944 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK13749 transcriptional regulator MerD; Provisional | Back alignment and domain information |
|---|
| >TIGR00122 birA_repr_reg BirA biotin operon repressor domain | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK10072 putative transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PRK09978 DNA-binding transcriptional regulator GadX; Provisional | Back alignment and domain information |
|---|
| >cd04772 HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding domain of the regulatory protein TioE | Back alignment and domain information |
|---|
| >PF05344 DUF746: Domain of Unknown Function (DUF746); InterPro: IPR008008 This is a short conserved region found in some transposons | Back alignment and domain information |
|---|
| >cd04778 HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PRK09642 RNA polymerase sigma factor SigW; Reviewed | Back alignment and domain information |
|---|
| >PRK15340 transcriptional regulator InvF; Provisional | Back alignment and domain information |
|---|
| >COG2901 Fis Factor for inversion stimulation Fis, transcriptional activator [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF12298 Bot1p: Eukaryotic mitochondrial regulator protein ; InterPro: IPR021036 This entry represents Ribosomal protein S35, which localises to the mitochondria in live cells and co-fractionates with purified mitochondrial ribosomes | Back alignment and domain information |
|---|
| >PRK06759 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK15418 transcriptional regulator LsrR; Provisional | Back alignment and domain information |
|---|
| >cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors | Back alignment and domain information |
|---|
| >PRK12525 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK10130 transcriptional regulator EutR; Provisional | Back alignment and domain information |
|---|
| >COG2973 TrpR Trp operon repressor [Transcription] | Back alignment and domain information |
|---|
| >COG2739 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family | Back alignment and domain information |
|---|
| >PF13022 HTH_Tnp_1_2: Helix-turn-helix of insertion element transposase; PDB: 2AO9_I | Back alignment and domain information |
|---|
| >PRK06288 RNA polymerase sigma factor WhiG; Reviewed | Back alignment and domain information |
|---|
| >PRK12547 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK10072 putative transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family | Back alignment and domain information |
|---|
| >PRK09642 RNA polymerase sigma factor SigW; Reviewed | Back alignment and domain information |
|---|
| >PRK11924 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PHA00738 putative HTH transcription regulator | Back alignment and domain information |
|---|
| >PRK09639 RNA polymerase sigma factor SigX; Provisional | Back alignment and domain information |
|---|
| >PRK06986 fliA flagellar biosynthesis sigma factor; Validated | Back alignment and domain information |
|---|
| >TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family | Back alignment and domain information |
|---|
| >COG2739 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK09646 RNA polymerase sigma factor SigK; Reviewed | Back alignment and domain information |
|---|
| >TIGR02366 DHAK_reg probable dihydroxyacetone kinase regulator | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK06474 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 | Back alignment and domain information |
|---|
| >PF00376 MerR: MerR family regulatory protein; InterPro: IPR000551 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >TIGR03070 couple_hipB transcriptional regulator, y4mF family | Back alignment and domain information |
|---|
| >PF12759 HTH_Tnp_IS1: InsA C-terminal domain; InterPro: IPR024431 This entry represents the helix-turn-helix domain found at the C-terminal of InsA | Back alignment and domain information |
|---|
| >PF05930 Phage_AlpA: Prophage CP4-57 regulatory protein (AlpA); InterPro: IPR010260 This entry is represents phage P4, Orf88 | Back alignment and domain information |
|---|
| >PF06627 DUF1153: Protein of unknown function (DUF1153); InterPro: IPR009534 This family consists of several short, hypothetical bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK12520 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09047 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PHA02591 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >PRK09644 RNA polymerase sigma factor SigM; Provisional | Back alignment and domain information |
|---|
| >TIGR02607 antidote_HigA addiction module antidote protein, HigA family | Back alignment and domain information |
|---|
| >PRK13919 putative RNA polymerase sigma E protein; Provisional | Back alignment and domain information |
|---|
| >PRK12528 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A | Back alignment and domain information |
|---|
| >PRK09415 RNA polymerase factor sigma C; Reviewed | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators | Back alignment and domain information |
|---|
| >TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family | Back alignment and domain information |
|---|
| >PF07638 Sigma70_ECF: ECF sigma factor | Back alignment and domain information |
|---|
| >PRK12543 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12540 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12532 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR00637 ModE_repress ModE molybdate transport repressor domain | Back alignment and domain information |
|---|
| >PRK10141 DNA-binding transcriptional repressor ArsR; Provisional | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK15121 right oriC-binding transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK12539 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1 | Back alignment and domain information |
|---|
| >smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK05602 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK12527 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK11179 DNA-binding transcriptional regulator AsnC; Provisional | Back alignment and domain information |
|---|
| >PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance | Back alignment and domain information |
|---|
| >PRK12514 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK12511 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12528 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF02042 RWP-RK: RWP-RK domain; InterPro: IPR003035 This domain is named RWP-RK after a conserved motif at the C terminus of the domain | Back alignment and domain information |
|---|
| >COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] | Back alignment and domain information |
|---|
| >COG1710 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PRK07037 extracytoplasmic-function sigma-70 factor; Validated | Back alignment and domain information |
|---|
| >COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] | Back alignment and domain information |
|---|
| >PRK12536 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >COG3877 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14549 P22_Cro: DNA-binding transcriptional regulator Cro; PDB: 1RZS_A 3BD1_A 3QWS_A 2HIN_B | Back alignment and domain information |
|---|
| >PF00440 TetR_N: Bacterial regulatory proteins, tetR family; InterPro: IPR001647 This entry represents a DNA-binding domain with a helix-turn-helix (HTH) structure that is found in several bacterial and archaeal transcriptional regulators, such as TetR, the tetracycline resistance repressor | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PRK12529 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK15340 transcriptional regulator InvF; Provisional | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PRK12530 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family | Back alignment and domain information |
|---|
| >TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family | Back alignment and domain information |
|---|
| >PRK11169 leucine-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK12519 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12529 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >smart00344 HTH_ASNC helix_turn_helix ASNC type | Back alignment and domain information |
|---|
| >PRK09644 RNA polymerase sigma factor SigM; Provisional | Back alignment and domain information |
|---|
| >PRK12516 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09637 RNA polymerase sigma factor SigZ; Provisional | Back alignment and domain information |
|---|
| >PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family | Back alignment and domain information |
|---|
| >PRK09648 RNA polymerase sigma factor SigD; Reviewed | Back alignment and domain information |
|---|
| >PRK12514 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PRK12541 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02959 SigZ RNA polymerase sigma factor, SigZ family | Back alignment and domain information |
|---|
| >PRK00430 fis global DNA-binding transcriptional dual regulator Fis; Provisional | Back alignment and domain information |
|---|
| >COG3413 Predicted DNA binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12533 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >COG1961 PinR Site-specific recombinases, DNA invertase Pin homologs [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09047 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK12547 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12519 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12523 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK11050 manganese transport regulator MntR; Provisional | Back alignment and domain information |
|---|
| >PRK12542 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12524 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >COG1522 Lrp Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK12526 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF12298 Bot1p: Eukaryotic mitochondrial regulator protein ; InterPro: IPR021036 This entry represents Ribosomal protein S35, which localises to the mitochondria in live cells and co-fractionates with purified mitochondrial ribosomes | Back alignment and domain information |
|---|
| >PRK12537 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09648 RNA polymerase sigma factor SigD; Reviewed | Back alignment and domain information |
|---|
| >PRK12530 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09645 RNA polymerase sigma factor SigL; Provisional | Back alignment and domain information |
|---|
| >COG1710 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PRK12527 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family | Back alignment and domain information |
|---|
| >TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family | Back alignment and domain information |
|---|
| >PRK08301 sporulation sigma factor SigE; Reviewed | Back alignment and domain information |
|---|
| >PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family | Back alignment and domain information |
|---|
| >PF11198 DUF2857: Protein of unknown function (DUF2857); InterPro: IPR021364 This is a bacterial family of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK12516 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK10130 transcriptional regulator EutR; Provisional | Back alignment and domain information |
|---|
| >PRK09685 DNA-binding transcriptional activator FeaR; Provisional | Back alignment and domain information |
|---|
| >PRK12522 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK03975 tfx putative transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily | Back alignment and domain information |
|---|
| >PF07638 Sigma70_ECF: ECF sigma factor | Back alignment and domain information |
|---|
| >PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional | Back alignment and domain information |
|---|
| >PRK05602 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK12542 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12512 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK06811 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A | Back alignment and domain information |
|---|
| >PRK12540 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK10100 DNA-binding transcriptional regulator CsgD; Provisional | Back alignment and domain information |
|---|
| >cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins | Back alignment and domain information |
|---|
| >smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor | Back alignment and domain information |
|---|
| >PRK12525 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR00721 tfx DNA-binding protein, Tfx family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 229 | |||
| 2cob_A | 70 | LCOR protein; MLR2, KIAA1795, helix-turn-helix, st | 2e-10 | |
| 2cob_A | 70 | LCOR protein; MLR2, KIAA1795, helix-turn-helix, st | 7e-08 | |
| 2cob_A | 70 | LCOR protein; MLR2, KIAA1795, helix-turn-helix, st | 1e-05 |
| >2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 Length = 70 | Back alignment and structure |
|---|
Score = 54.4 bits (130), Expect = 2e-10
Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
Query: 106 ANKASKAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTL-YKIARKEGIRLA 164
+ S G + +N EIL A+ + +G +S +KA YGIP STL YK+ + G
Sbjct: 1 GSSGSSGRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKN 60
Query: 165 QP 166
P
Sbjct: 61 PP 62
|
| >2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 Length = 70 | Back alignment and structure |
|---|
| >2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 Length = 70 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 99.38 | |
| 2k27_A | 159 | Paired box protein PAX-8; paired domain, solution | 99.37 | |
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 99.31 | |
| 1k78_A | 149 | Paired box protein PAX5; paired domain, ETS domain | 99.29 | |
| 1pdn_C | 128 | Protein (PRD paired); protein-DNA complex, double | 99.22 | |
| 1k78_A | 149 | Paired box protein PAX5; paired domain, ETS domain | 99.17 | |
| 2cob_A | 70 | LCOR protein; MLR2, KIAA1795, helix-turn-helix, st | 99.16 | |
| 1pdn_C | 128 | Protein (PRD paired); protein-DNA complex, double | 99.11 | |
| 2k27_A | 159 | Paired box protein PAX-8; paired domain, solution | 99.04 | |
| 2cob_A | 70 | LCOR protein; MLR2, KIAA1795, helix-turn-helix, st | 98.9 | |
| 2jn6_A | 97 | Protein CGL2762, transposase; GFT PSI-2, protein s | 98.7 | |
| 2glo_A | 59 | Brinker CG9653-PA; protein-DNA complex, helix-turn | 98.61 | |
| 2glo_A | 59 | Brinker CG9653-PA; protein-DNA complex, helix-turn | 98.52 | |
| 2elh_A | 87 | CG11849-PA, LD40883P; structural genomics, NPPSFA, | 98.51 | |
| 2jn6_A | 97 | Protein CGL2762, transposase; GFT PSI-2, protein s | 98.49 | |
| 2jrt_A | 95 | Uncharacterized protein; solution, structure, NESG | 98.48 | |
| 2rn7_A | 108 | IS629 ORFA; helix, all alpha, unknown function, st | 98.47 | |
| 2elh_A | 87 | CG11849-PA, LD40883P; structural genomics, NPPSFA, | 98.35 | |
| 2rn7_A | 108 | IS629 ORFA; helix, all alpha, unknown function, st | 98.3 | |
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 98.28 | |
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 98.26 | |
| 1jko_C | 52 | HIN recombinase, DNA-invertase HIN; water-mediated | 98.24 | |
| 2jrt_A | 95 | Uncharacterized protein; solution, structure, NESG | 98.21 | |
| 3hot_A | 345 | Transposable element mariner, complete CDS; protei | 98.2 | |
| 1jko_C | 52 | HIN recombinase, DNA-invertase HIN; water-mediated | 98.05 | |
| 3hot_A | 345 | Transposable element mariner, complete CDS; protei | 98.05 | |
| 1hlv_A | 131 | CENP-B, major centromere autoantigen B; helix-turn | 98.05 | |
| 2oa4_A | 101 | SIR5; structure, structural genomics, PSI-2, prote | 97.95 | |
| 1hlv_A | 131 | CENP-B, major centromere autoantigen B; helix-turn | 97.9 | |
| 2oa4_A | 101 | SIR5; structure, structural genomics, PSI-2, prote | 97.78 | |
| 2ao9_A | 155 | Phage protein; structural genomics, nine-fold NCS. | 97.66 | |
| 4dyq_A | 140 | Gene 1 protein; GP1, octamer, DNA-binding, viral p | 97.66 | |
| 2ao9_A | 155 | Phage protein; structural genomics, nine-fold NCS. | 97.47 | |
| 3oou_A | 108 | LIN2118 protein; protein structure initiative, PSI | 97.36 | |
| 3uj3_X | 193 | DNA-invertase; helix-turn-helix, site-specific rec | 97.36 | |
| 3lsg_A | 103 | Two-component response regulator YESN; structural | 97.35 | |
| 3e7l_A | 63 | Transcriptional regulator (NTRC family); sigma43 a | 97.23 | |
| 3mn2_A | 108 | Probable ARAC family transcriptional regulator; st | 97.2 | |
| 1g2h_A | 61 | Transcriptional regulatory protein TYRR homolog; p | 97.18 | |
| 3mkl_A | 120 | HTH-type transcriptional regulator GADX; PSI2, MCS | 97.14 | |
| 3oio_A | 113 | Transcriptional regulator (ARAC-type DNA-binding c | 97.11 | |
| 4dyq_A | 140 | Gene 1 protein; GP1, octamer, DNA-binding, viral p | 97.09 | |
| 2k9s_A | 107 | Arabinose operon regulatory protein; activator, ar | 97.07 | |
| 1gdt_A | 183 | GD resolvase, protein (gamma delta resolvase); pro | 97.06 | |
| 2r0q_C | 209 | Putative transposon TN552 DNA-invertase BIN3; site | 97.02 | |
| 1umq_A | 81 | Photosynthetic apparatus regulatory protein; DNA-b | 96.97 | |
| 3plo_X | 193 | DNA-invertase; resolvase, helix-turn-helix, serine | 96.91 | |
| 2x48_A | 55 | CAG38821; archeal virus, viral protein; 2.60A {Sul | 96.89 | |
| 1bl0_A | 129 | Protein (multiple antibiotic resistance protein), | 96.83 | |
| 2x48_A | 55 | CAG38821; archeal virus, viral protein; 2.60A {Sul | 96.71 | |
| 1ntc_A | 91 | Protein (nitrogen regulation protein (NTRC)); heli | 96.68 | |
| 4ich_A | 311 | Transcriptional regulator; structural genomics, PS | 96.65 | |
| 2jml_A | 81 | DNA binding domain/transcriptional regulator; anti | 96.56 | |
| 1vz0_A | 230 | PARB, chromosome partitioning protein PARB; nuclea | 96.53 | |
| 3lsg_A | 103 | Two-component response regulator YESN; structural | 96.44 | |
| 1eto_A | 98 | FIS, factor for inversion stimulation; transcripti | 96.42 | |
| 2jml_A | 81 | DNA binding domain/transcriptional regulator; anti | 96.38 | |
| 3oou_A | 108 | LIN2118 protein; protein structure initiative, PSI | 96.34 | |
| 3e7l_A | 63 | Transcriptional regulator (NTRC family); sigma43 a | 96.31 | |
| 1iuf_A | 144 | Centromere ABP1 protein; riken structural genomics | 96.22 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 96.18 | |
| 3oio_A | 113 | Transcriptional regulator (ARAC-type DNA-binding c | 96.18 | |
| 3mn2_A | 108 | Probable ARAC family transcriptional regulator; st | 96.16 | |
| 4fcy_A | 529 | Transposase; rnaseh, DDE transposase, DNA binding | 96.14 | |
| 2vz4_A | 108 | Tipal, HTH-type transcriptional activator TIPA; tr | 95.95 | |
| 3uj3_X | 193 | DNA-invertase; helix-turn-helix, site-specific rec | 95.91 | |
| 1bl0_A | 129 | Protein (multiple antibiotic resistance protein), | 95.84 | |
| 2k9s_A | 107 | Arabinose operon regulatory protein; activator, ar | 95.79 | |
| 4fcy_A | 529 | Transposase; rnaseh, DDE transposase, DNA binding | 95.73 | |
| 1jhg_A | 101 | Trp operon repressor; complex (regulatory protein- | 95.65 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 95.6 | |
| 1r8d_A | 109 | Transcription activator MTAN; protein-DNA complex, | 95.57 | |
| 1iuf_A | 144 | Centromere ABP1 protein; riken structural genomics | 95.53 | |
| 4fe7_A | 412 | Xylose operon regulatory protein; HTH_ARAC, helix- | 95.48 | |
| 2vz4_A | 108 | Tipal, HTH-type transcriptional activator TIPA; tr | 95.34 | |
| 2o8x_A | 70 | Probable RNA polymerase sigma-C factor; promoter r | 95.32 | |
| 3mkl_A | 120 | HTH-type transcriptional regulator GADX; PSI2, MCS | 95.31 | |
| 1q06_A | 135 | Transcriptional regulator CUER; MERR family transc | 95.3 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 95.29 | |
| 1umq_A | 81 | Photosynthetic apparatus regulatory protein; DNA-b | 95.27 | |
| 3gp4_A | 142 | Transcriptional regulator, MERR family; structural | 95.04 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 95.01 | |
| 1d5y_A | 292 | ROB transcription factor; protein-DNA complex, DNA | 95.01 | |
| 1r8d_A | 109 | Transcription activator MTAN; protein-DNA complex, | 95.01 | |
| 1ntc_A | 91 | Protein (nitrogen regulation protein (NTRC)); heli | 94.99 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 94.97 | |
| 1g2h_A | 61 | Transcriptional regulatory protein TYRR homolog; p | 94.95 | |
| 1j9i_A | 68 | GPNU1 DBD;, terminase small subunit; DNA binding d | 94.95 | |
| 2l1p_A | 83 | DNA-binding protein SATB1; PSI-biology, NESG, stru | 94.95 | |
| 1z4h_A | 66 | TORI, TOR inhibition protein; winged helix, revers | 94.9 | |
| 1fse_A | 74 | GERE; helix-turn-helix DNA-binding protein transcr | 94.84 | |
| 1jhg_A | 101 | Trp operon repressor; complex (regulatory protein- | 94.83 | |
| 3hh0_A | 146 | Transcriptional regulator, MERR family; protein st | 94.8 | |
| 1q06_A | 135 | Transcriptional regulator CUER; MERR family transc | 94.73 | |
| 3gp4_A | 142 | Transcriptional regulator, MERR family; structural | 94.65 | |
| 1neq_A | 74 | DNA-binding protein NER; NMR {Enterobacteria phage | 94.53 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 94.5 | |
| 2w7n_A | 101 | TRFB transcriptional repressor protein; INCP, plas | 94.44 | |
| 1s7o_A | 113 | Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP | 94.43 | |
| 2jpc_A | 61 | SSRB; DNA binding protein, structural genomics, PS | 94.43 | |
| 2l0k_A | 93 | Stage III sporulation protein D; SPOIIID, solution | 94.42 | |
| 3hh0_A | 146 | Transcriptional regulator, MERR family; protein st | 94.41 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 94.35 | |
| 2hin_A | 71 | GP39, repressor protein; transcription factor, dim | 94.32 | |
| 3plo_X | 193 | DNA-invertase; resolvase, helix-turn-helix, serine | 94.24 | |
| 2jpc_A | 61 | SSRB; DNA binding protein, structural genomics, PS | 94.21 | |
| 3gpv_A | 148 | Transcriptional regulator, MERR family; protein st | 94.16 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 94.16 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 94.16 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 94.12 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 94.09 | |
| 2o8x_A | 70 | Probable RNA polymerase sigma-C factor; promoter r | 94.01 | |
| 3hug_A | 92 | RNA polymerase sigma factor; ECF sigma factor, zin | 93.93 | |
| 1je8_A | 82 | Nitrate/nitrite response regulator protein NARL; p | 93.91 | |
| 2p7v_B | 68 | Sigma-70, RNA polymerase sigma factor RPOD; RSD, r | 93.9 | |
| 1x3u_A | 79 | Transcriptional regulatory protein FIXJ; helix-tur | 93.86 | |
| 3gpv_A | 148 | Transcriptional regulator, MERR family; protein st | 93.81 | |
| 1p4w_A | 99 | RCSB; solution structure, DNA binding domain, DNA | 93.8 | |
| 1fse_A | 74 | GERE; helix-turn-helix DNA-binding protein transcr | 93.78 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 93.77 | |
| 2fu4_A | 83 | Ferric uptake regulation protein; DNA binding doma | 93.76 | |
| 1s7o_A | 113 | Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP | 93.74 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 93.67 | |
| 2l0k_A | 93 | Stage III sporulation protein D; SPOIIID, solution | 93.67 | |
| 1ku3_A | 73 | Sigma factor SIGA; helix-turn-helix, transcription | 93.65 | |
| 1z4h_A | 66 | TORI, TOR inhibition protein; winged helix, revers | 93.51 | |
| 2vxz_A | 165 | Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Py | 93.48 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 93.46 | |
| 1je8_A | 82 | Nitrate/nitrite response regulator protein NARL; p | 93.4 | |
| 2w7n_A | 101 | TRFB transcriptional repressor protein; INCP, plas | 93.39 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 93.37 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 93.31 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 93.28 | |
| 2zhg_A | 154 | Redox-sensitive transcriptional activator SOXR; ox | 93.27 | |
| 1gdt_A | 183 | GD resolvase, protein (gamma delta resolvase); pro | 93.26 | |
| 3kz3_A | 80 | Repressor protein CI; five helix bundle, DNA-bindi | 93.26 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 93.21 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 93.19 | |
| 1eto_A | 98 | FIS, factor for inversion stimulation; transcripti | 93.19 | |
| 1x3u_A | 79 | Transcriptional regulatory protein FIXJ; helix-tur | 93.19 | |
| 2r0q_C | 209 | Putative transposon TN552 DNA-invertase BIN3; site | 93.13 | |
| 2hin_A | 71 | GP39, repressor protein; transcription factor, dim | 93.12 | |
| 3f6o_A | 118 | Probable transcriptional regulator, ARSR family pr | 93.04 | |
| 2dg6_A | 222 | Putative transcriptional regulator; winged-helix m | 93.04 | |
| 2dg6_A | 222 | Putative transcriptional regulator; winged-helix m | 93.01 | |
| 1zx4_A | 192 | P1 PARB, plasmid partition PAR B protein, PARB; tr | 93.0 | |
| 1p4w_A | 99 | RCSB; solution structure, DNA binding domain, DNA | 92.99 | |
| 3c57_A | 95 | Two component transcriptional regulatory protein; | 92.94 | |
| 2pjp_A | 121 | Selenocysteine-specific elongation factor; SELB, p | 92.9 | |
| 1d5y_A | 292 | ROB transcription factor; protein-DNA complex, DNA | 92.89 | |
| 2p7v_B | 68 | Sigma-70, RNA polymerase sigma factor RPOD; RSD, r | 92.86 | |
| 2p5k_A | 64 | Arginine repressor; DNA-binding domain, winged hel | 92.85 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 92.85 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 92.8 | |
| 3m8j_A | 111 | FOCB protein; all-alpha, helix-turn-helix, transcr | 92.78 | |
| 1tty_A | 87 | Sigma-A, RNA polymerase sigma factor RPOD; helix-t | 92.77 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 92.69 | |
| 3fmy_A | 73 | HTH-type transcriptional regulator MQSA (YGIT/B302 | 92.64 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 92.64 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 92.61 | |
| 3frw_A | 107 | Putative Trp repressor protein; structural genomic | 92.61 | |
| 1ku3_A | 73 | Sigma factor SIGA; helix-turn-helix, transcription | 92.59 | |
| 2zhg_A | 154 | Redox-sensitive transcriptional activator SOXR; ox | 92.53 | |
| 2cw1_A | 65 | SN4M; lambda CRO fold, de novo protein; NMR {Synth | 92.51 | |
| 3hug_A | 92 | RNA polymerase sigma factor; ECF sigma factor, zin | 92.51 | |
| 1uxc_A | 65 | FRUR (1-57), fructose repressor; DNA-binding prote | 92.49 | |
| 3mzy_A | 164 | RNA polymerase sigma-H factor; PSI, MCSG, structur | 92.42 | |
| 1xsv_A | 113 | Hypothetical UPF0122 protein SAV1236; helix-turn-h | 92.39 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 92.38 | |
| 3ulq_B | 90 | Transcriptional regulatory protein COMA; tetratric | 92.22 | |
| 1r71_A | 178 | Transcriptional repressor protein KORB; INCP, plas | 92.21 | |
| 2p5k_A | 64 | Arginine repressor; DNA-binding domain, winged hel | 92.2 | |
| 3kor_A | 119 | Possible Trp repressor; putative DNA-binding Trp r | 92.18 | |
| 3qao_A | 249 | LMO0526 protein, MERR-like transcriptional regulat | 92.14 | |
| 2jsc_A | 118 | Transcriptional regulator RV1994C/MT2050; cadmium, | 92.13 | |
| 1u2w_A | 122 | CADC repressor, cadmium efflux system accessory pr | 92.12 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 92.05 | |
| 1r1t_A | 122 | Transcriptional repressor SMTB; zinc, transcriptio | 92.05 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 91.99 | |
| 3c57_A | 95 | Two component transcriptional regulatory protein; | 91.97 | |
| 2wiu_B | 88 | HTH-type transcriptional regulator HIPB; transfera | 91.97 | |
| 3kor_A | 119 | Possible Trp repressor; putative DNA-binding Trp r | 91.95 | |
| 2rnj_A | 91 | Response regulator protein VRAR; HTH LUXR-type dom | 91.92 | |
| 1j9i_A | 68 | GPNU1 DBD;, terminase small subunit; DNA binding d | 91.92 | |
| 2rnj_A | 91 | Response regulator protein VRAR; HTH LUXR-type dom | 91.9 | |
| 4fe7_A | 412 | Xylose operon regulatory protein; HTH_ARAC, helix- | 91.87 | |
| 3frw_A | 107 | Putative Trp repressor protein; structural genomic | 91.8 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 91.79 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 91.74 | |
| 2o3f_A | 111 | Putative HTH-type transcriptional regulator YBBH; | 91.71 | |
| 1rzs_A | 61 | Antirepressor, regulatory protein CRO; helix-turn- | 91.69 | |
| 2xi8_A | 66 | Putative transcription regulator; HTH DNA-binding | 91.62 | |
| 3mzy_A | 164 | RNA polymerase sigma-H factor; PSI, MCSG, structur | 91.54 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 91.5 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 91.47 | |
| 1xsv_A | 113 | Hypothetical UPF0122 protein SAV1236; helix-turn-h | 91.46 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 91.45 | |
| 1r69_A | 69 | Repressor protein CI; gene regulating protein; 2.0 | 91.42 | |
| 1tty_A | 87 | Sigma-A, RNA polymerase sigma factor RPOD; helix-t | 91.17 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 91.16 | |
| 2pij_A | 67 | Prophage PFL 6 CRO; transcription factor, helix-tu | 91.14 | |
| 1lmb_3 | 92 | Protein (lambda repressor); protein-DNA complex, d | 91.07 | |
| 2jsc_A | 118 | Transcriptional regulator RV1994C/MT2050; cadmium, | 91.06 | |
| 3ulq_B | 90 | Transcriptional regulatory protein COMA; tetratric | 90.98 | |
| 3qao_A | 249 | LMO0526 protein, MERR-like transcriptional regulat | 90.96 | |
| 3b7h_A | 78 | Prophage LP1 protein 11; structural genomics, PSI2 | 90.8 | |
| 3omt_A | 73 | Uncharacterized protein; structural genomics, PSI- | 90.8 | |
| 2ia0_A | 171 | Putative HTH-type transcriptional regulator PF086; | 90.73 | |
| 1r69_A | 69 | Repressor protein CI; gene regulating protein; 2.0 | 90.71 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 90.7 | |
| 1zug_A | 71 | Phage 434 CRO protein; gene regulating protein, tr | 90.64 | |
| 2l8n_A | 67 | Transcriptional repressor CYTR; bacterial gene rep | 90.63 | |
| 1sfu_A | 75 | 34L protein; protein/Z-DNA complex, DNA binding pr | 90.61 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 90.6 | |
| 1b0n_A | 111 | Protein (SINR protein); transcription regulator, a | 90.57 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 90.51 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 90.48 | |
| 3i4p_A | 162 | Transcriptional regulator, ASNC family; PSI, struc | 90.4 | |
| 2w48_A | 315 | Sorbitol operon regulator; SORC, activator, repres | 90.37 | |
| 3bs3_A | 76 | Putative DNA-binding protein; XRE-family, structur | 90.36 | |
| 2zkz_A | 99 | Transcriptional repressor PAGR; protein-DNA, HTH m | 90.36 | |
| 2ofy_A | 86 | Putative XRE-family transcriptional regulator; tra | 90.34 | |
| 1zug_A | 71 | Phage 434 CRO protein; gene regulating protein, tr | 90.3 | |
| 1r1t_A | 122 | Transcriptional repressor SMTB; zinc, transcriptio | 90.28 | |
| 3trb_A | 104 | Virulence-associated protein I; mobIle and extrach | 90.22 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 90.16 | |
| 2ovg_A | 66 | Phage lambda CRO; transcription factor, helix-turn | 90.15 | |
| 3op9_A | 114 | PLI0006 protein; structural genomics, PSI-2, prote | 90.08 | |
| 1u2w_A | 122 | CADC repressor, cadmium efflux system accessory pr | 90.07 | |
| 2pij_A | 67 | Prophage PFL 6 CRO; transcription factor, helix-tu | 90.0 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 89.97 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 89.95 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 89.93 | |
| 1x57_A | 91 | Endothelial differentiation-related factor 1; HMBF | 89.92 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 89.87 | |
| 3f6o_A | 118 | Probable transcriptional regulator, ARSR family pr | 89.85 | |
| 3ivp_A | 126 | Putative transposon-related DNA-binding protein; A | 89.77 | |
| 3b7h_A | 78 | Prophage LP1 protein 11; structural genomics, PSI2 | 89.72 | |
| 1uxc_A | 65 | FRUR (1-57), fructose repressor; DNA-binding prote | 89.71 | |
| 2xi8_A | 66 | Putative transcription regulator; HTH DNA-binding | 89.68 | |
| 2zkz_A | 99 | Transcriptional repressor PAGR; protein-DNA, HTH m | 89.68 | |
| 1neq_A | 74 | DNA-binding protein NER; NMR {Enterobacteria phage | 89.61 | |
| 3f6v_A | 151 | Possible transcriptional regulator, ARSR family pr | 89.59 | |
| 1i1g_A | 141 | Transcriptional regulator LRPA; helix-turn-helix, | 89.52 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 89.51 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 89.47 | |
| 1on2_A | 142 | Transcriptional regulator MNTR; helix-turn-helix, | 89.43 | |
| 2qlz_A | 232 | Transcription factor PF0095; 2.50A {Pyrococcus fur | 89.41 | |
| 2a6c_A | 83 | Helix-turn-helix motif; putative transcriptional r | 89.41 | |
| 2a6c_A | 83 | Helix-turn-helix motif; putative transcriptional r | 89.34 | |
| 2dbb_A | 151 | Putative HTH-type transcriptional regulator PH006; | 89.31 | |
| 2r1j_L | 68 | Repressor protein C2; protein-DNA complex, helix-t | 89.26 | |
| 3o9x_A | 133 | Uncharacterized HTH-type transcriptional regulato; | 89.25 | |
| 1j5y_A | 187 | Transcriptional regulator, biotin repressor famil; | 89.21 | |
| 4g6q_A | 182 | Putative uncharacterized protein; structural genom | 89.19 | |
| 1or7_A | 194 | Sigma-24, RNA polymerase sigma-E factor; regulatio | 89.18 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 89.0 | |
| 1y7y_A | 74 | C.AHDI; helix-turn-helix, DNA-binding protein, tra | 88.99 | |
| 3iwf_A | 107 | Transcription regulator RPIR family; transcription | 88.95 | |
| 2w25_A | 150 | Probable transcriptional regulatory protein; trans | 88.94 | |
| 2p5v_A | 162 | Transcriptional regulator, LRP/ASNC family; NMB057 | 88.87 | |
| 3ppb_A | 195 | Putative TETR family transcription regulator; DNA- | 88.8 | |
| 1j5y_A | 187 | Transcriptional regulator, biotin repressor famil; | 88.75 | |
| 2jvl_A | 107 | TRMBF1; coactivator, helix-turn-helix, Pro binding | 88.7 | |
| 2b5a_A | 77 | C.BCLI; helix-turn-helix motif, gene regulation; 1 | 88.64 | |
| 2cfx_A | 144 | HTH-type transcriptional regulator LRPC; transcrip | 88.56 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 88.54 | |
| 3t76_A | 88 | VANU, transcriptional regulator vanug; structural | 88.47 | |
| 1adr_A | 76 | P22 C2 repressor; transcription regulation; NMR {E | 88.42 | |
| 1uly_A | 192 | Hypothetical protein PH1932; helix-turn-helix, str | 88.39 | |
| 2qko_A | 215 | Possible transcriptional regulator, TETR family P; | 88.37 | |
| 2fu4_A | 83 | Ferric uptake regulation protein; DNA binding doma | 88.3 | |
| 2pn6_A | 150 | ST1022, 150AA long hypothetical transcriptional re | 88.29 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 88.24 | |
| 2pn6_A | 150 | ST1022, 150AA long hypothetical transcriptional re | 88.21 | |
| 2x4h_A | 139 | Hypothetical protein SSO2273; transcription; 2.30A | 88.21 | |
| 2cw1_A | 65 | SN4M; lambda CRO fold, de novo protein; NMR {Synth | 88.21 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 88.12 | |
| 3tqn_A | 113 | Transcriptional regulator, GNTR family; regulatory | 88.06 | |
| 2opt_A | 234 | Actii protein; helical protein, TETR family, APO-p | 88.01 | |
| 3bs3_A | 76 | Putative DNA-binding protein; XRE-family, structur | 87.98 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 87.95 | |
| 2kpj_A | 94 | SOS-response transcriptional repressor, LEXA; NESG | 87.93 | |
| 1uly_A | 192 | Hypothetical protein PH1932; helix-turn-helix, str | 87.93 | |
| 2r1j_L | 68 | Repressor protein C2; protein-DNA complex, helix-t | 87.89 | |
| 2cg4_A | 152 | Regulatory protein ASNC; DNA binding, FFRP, LRP fa | 87.82 | |
| 3dcf_A | 218 | Transcriptional regulator of the TETR/ACRR family; | 87.76 | |
| 3b73_A | 111 | PHIH1 repressor-like protein; winged-helix-turn-he | 87.74 | |
| 2ict_A | 94 | Antitoxin HIGA; helix-turn-helix, structural genom | 87.7 | |
| 3omt_A | 73 | Uncharacterized protein; structural genomics, PSI- | 87.67 | |
| 3neu_A | 125 | LIN1836 protein; structural genomics, PSI-2, prote | 87.56 | |
| 2k9q_A | 77 | Uncharacterized protein; all helix, helix-turn-hel | 87.54 | |
| 3qkx_A | 188 | Uncharacterized HTH-type transcriptional regulato; | 87.54 | |
| 3nxc_A | 212 | HTH-type protein SLMA; nucleoid occlusion, cell di | 87.53 | |
| 3qq6_A | 78 | HTH-type transcriptional regulator SINR; helix-tur | 87.49 | |
| 3bd1_A | 79 | CRO protein; transcription factor, helix-turn-heli | 87.44 | |
| 2b5a_A | 77 | C.BCLI; helix-turn-helix motif, gene regulation; 1 | 87.43 | |
| 1ku9_A | 152 | Hypothetical protein MJ223; putative transcription | 87.38 | |
| 3t72_q | 99 | RNA polymerase sigma factor RPOD, DNA-directed RN | 87.35 | |
| 1y7y_A | 74 | C.AHDI; helix-turn-helix, DNA-binding protein, tra | 87.34 | |
| 2ef8_A | 84 | C.ECOT38IS, putative transcription factor; helix-t | 87.28 | |
| 2w25_A | 150 | Probable transcriptional regulatory protein; trans | 87.13 | |
| 2l1p_A | 83 | DNA-binding protein SATB1; PSI-biology, NESG, stru | 87.03 | |
| 1r8e_A | 278 | Multidrug-efflux transporter regulator; protein-DN | 86.98 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 86.94 | |
| 2yve_A | 185 | Transcriptional regulator; helix-turn-helix, TETR- | 86.9 | |
| 3s8q_A | 82 | R-M controller protein; protein-DNA complex, helix | 86.86 | |
| 2lfw_A | 157 | PHYR sigma-like domain; signal transduction, respo | 86.86 | |
| 3i4p_A | 162 | Transcriptional regulator, ASNC family; PSI, struc | 86.84 | |
| 2g7g_A | 213 | RHA04620, putative transcriptional regulator; heli | 86.82 | |
| 2xvc_A | 59 | ESCRT-III, SSO0910; cell cycle, cell division, cyt | 86.82 | |
| 2ewt_A | 71 | BLDD, putative DNA-binding protein; the DNA-bindin | 86.81 | |
| 3f6w_A | 83 | XRE-family like protein; helix-turn-helix, DNA bin | 86.78 | |
| 2p5v_A | 162 | Transcriptional regulator, LRP/ASNC family; NMB057 | 86.77 | |
| 2hxi_A | 241 | Putative transcriptional regulator; structural gen | 86.77 | |
| 2ek5_A | 129 | Predicted transcriptional regulators; helix-turn-h | 86.76 | |
| 2wiu_B | 88 | HTH-type transcriptional regulator HIPB; transfera | 86.68 | |
| 3kxa_A | 141 | NGO0477 protein, putative uncharacterized protein; | 86.68 | |
| 1rp3_A | 239 | RNA polymerase sigma factor sigma-28 (FLIA); trans | 86.65 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 86.63 | |
| 3eus_A | 86 | DNA-binding protein; structural genomics, PSI2,MCS | 86.63 | |
| 4hku_A | 178 | LMO2814 protein, TETR transcriptional regulator; s | 86.62 | |
| 2lfw_A | 157 | PHYR sigma-like domain; signal transduction, respo | 86.6 | |
| 2l8n_A | 67 | Transcriptional repressor CYTR; bacterial gene rep | 86.6 | |
| 2pz9_A | 226 | Putative regulatory protein; structural genomics, | 86.59 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 86.58 | |
| 2cg4_A | 152 | Regulatory protein ASNC; DNA binding, FFRP, LRP fa | 86.56 | |
| 1sgm_A | 191 | Putative HTH-type transcriptional regulator YXAF; | 86.4 | |
| 3dew_A | 206 | Transcriptional regulator, TETR family; S genomics | 86.38 | |
| 3t72_q | 99 | RNA polymerase sigma factor RPOD, DNA-directed RN | 86.38 | |
| 2xpw_A | 207 | Tetracycline repressor protein class D; transcript | 86.37 | |
| 2cfx_A | 144 | HTH-type transcriptional regulator LRPC; transcrip | 86.35 | |
| 1i1g_A | 141 | Transcriptional regulator LRPA; helix-turn-helix, | 86.35 | |
| 2p4w_A | 202 | Transcriptional regulatory protein ARSR family; ar | 86.33 | |
| 2ev1_A | 222 | Hypothetical protein RV1264/MT1302; alpha-helical, | 86.32 | |
| 1adr_A | 76 | P22 C2 repressor; transcription regulation; NMR {E | 86.3 | |
| 3fiw_A | 211 | Putative TETR-family transcriptional regulator; TE | 86.25 | |
| 3kz3_A | 80 | Repressor protein CI; five helix bundle, DNA-bindi | 86.25 | |
| 1or7_A | 194 | Sigma-24, RNA polymerase sigma-E factor; regulatio | 86.16 | |
| 3egq_A | 170 | TETR family transcriptional regulator; DNA-binding | 85.99 | |
| 2f2e_A | 146 | PA1607; transcription factor, helix-TRUN-helix, AP | 85.96 | |
| 3lfp_A | 98 | CSP231I C protein; transcriptional regulator, DNA | 85.91 | |
| 1zk8_A | 183 | Transcriptional regulator, TETR family; TETR membe | 85.91 | |
| 2ppx_A | 99 | AGR_C_3184P, uncharacterized protein ATU1735; HTH- | 85.83 | |
| 2dg7_A | 195 | Putative transcriptional regulator; helix-turn-hel | 85.79 | |
| 1z7u_A | 112 | Hypothetical protein EF0647; winged-helix-turn-hel | 85.74 | |
| 1r8e_A | 278 | Multidrug-efflux transporter regulator; protein-DN | 85.74 | |
| 2qwt_A | 196 | Transcriptional regulator, TETR family; structural | 85.73 | |
| 3tqn_A | 113 | Transcriptional regulator, GNTR family; regulatory | 85.68 | |
| 3iuo_A | 122 | ATP-dependent DNA helicase RECQ; C-terminal, GI PS | 85.41 | |
| 2pjp_A | 121 | Selenocysteine-specific elongation factor; SELB, p | 85.4 | |
| 2hzt_A | 107 | Putative HTH-type transcriptional regulator YTCD; | 85.36 | |
| 3kz9_A | 206 | SMCR; transcriptional regulator, quorum S DNA-bind | 85.28 | |
| 3bqz_B | 194 | HTH-type transcriptional regulator QACR; multidrug | 85.24 | |
| 2q1z_A | 184 | RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc | 85.24 | |
| 2l49_A | 99 | C protein; P2 bacteriophage, P2 C, direct repeats, | 85.19 | |
| 3bd1_A | 79 | CRO protein; transcription factor, helix-turn-heli | 85.18 | |
| 4ghj_A | 101 | Probable transcriptional regulator; structural gen | 85.17 | |
| 2fq4_A | 192 | Transcriptional regulator, TETR family; DNA-bindin | 85.01 | |
| 1b0n_A | 111 | Protein (SINR protein); transcription regulator, a | 84.97 | |
| 3gzi_A | 218 | Transcriptional regulator, TETR family; TETR famil | 84.9 | |
| 1zx4_A | 192 | P1 PARB, plasmid partition PAR B protein, PARB; tr | 84.89 | |
| 3by6_A | 126 | Predicted transcriptional regulator; structural ge | 84.86 | |
| 1rzs_A | 61 | Antirepressor, regulatory protein CRO; helix-turn- | 84.84 | |
| 2nnn_A | 140 | Probable transcriptional regulator; structural gen | 84.83 | |
| 2kpj_A | 94 | SOS-response transcriptional repressor, LEXA; NESG | 84.8 | |
| 1l3l_A | 234 | Transcriptional activator protein TRAR; helix-turn | 84.78 | |
| 1jhf_A | 202 | LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 | 84.72 | |
| 3vp5_A | 189 | Transcriptional regulator; heme, sensor protein, T | 84.68 | |
| 3k2z_A | 196 | LEXA repressor; winged helix-turn-helix, SOS syste | 84.65 | |
| 2rae_A | 207 | Transcriptional regulator, ACRR family protein; TE | 84.65 | |
| 2h09_A | 155 | Transcriptional regulator MNTR; transcription regu | 84.64 | |
| 3f1b_A | 203 | TETR-like transcriptional regulator; APC5888, rhod | 84.63 | |
| 4ac0_A | 202 | Tetracycline repressor protein class B from trans | 84.59 | |
| 1z0x_A | 220 | Transcriptional regulator, TETR family; structural | 84.56 | |
| 1vz0_A | 230 | PARB, chromosome partitioning protein PARB; nuclea | 84.54 | |
| 3lwj_A | 202 | Putative TETR-family transcriptional regulator; st | 84.46 | |
| 3bpv_A | 138 | Transcriptional regulator; MARR, DNA binding, tran | 84.4 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 84.4 | |
| 3lhq_A | 220 | Acrab operon repressor (TETR/ACRR family); structu | 84.4 | |
| 3ljl_A | 156 | Transcriptional regulator LUXT; structural genomic | 84.31 | |
| 3f6v_A | 151 | Possible transcriptional regulator, ARSR family pr | 84.29 | |
| 2zcm_A | 192 | Biofilm operon icaabcd HTH-type negative transcri | 84.27 | |
| 2ef8_A | 84 | C.ECOT38IS, putative transcription factor; helix-t | 84.24 | |
| 1v4r_A | 102 | Transcriptional repressor; helix-turn-helix, winge | 84.15 | |
| 2dbb_A | 151 | Putative HTH-type transcriptional regulator PH006; | 84.1 | |
| 3neu_A | 125 | LIN1836 protein; structural genomics, PSI-2, prote | 83.95 | |
| 4aci_A | 191 | HTH-type transcriptional repressor ACNR; aconitase | 83.82 | |
| 2qtq_A | 213 | Transcriptional regulator, TETR family; transcript | 83.77 | |
| 3vpr_A | 190 | Transcriptional regulator, TETR family; all alpha, | 83.73 | |
| 3qq6_A | 78 | HTH-type transcriptional regulator SINR; helix-tur | 83.65 | |
| 3on4_A | 191 | Transcriptional regulator, TETR family; structural | 83.59 | |
| 2ewt_A | 71 | BLDD, putative DNA-binding protein; the DNA-bindin | 83.56 | |
| 1y6u_A | 70 | XIS, excisionase from transposon TN916; structure, | 83.56 | |
| 3o60_A | 185 | LIN0861 protein; PSI, MCSG, structural genomics, m | 83.48 | |
| 2hxo_A | 237 | Putative TETR-family transcriptional regulator; TE | 83.45 | |
| 3t76_A | 88 | VANU, transcriptional regulator vanug; structural | 83.41 | |
| 2g7s_A | 194 | Transcriptional regulator, TETR family; APC5906, P | 83.4 | |
| 3nrv_A | 148 | Putative transcriptional regulator (MARR/EMRR FAM; | 83.37 | |
| 2a61_A | 145 | Transcriptional regulator TM0710; APC4350, MCSG, m | 83.34 | |
| 2dg8_A | 193 | Putative TETR-family transcriptional regulatory P; | 83.34 | |
| 2d6y_A | 202 | Putative TETR family regulatory protein; helix-tur | 83.29 | |
| 3bjb_A | 207 | Probable transcriptional regulator, TETR family P; | 83.27 | |
| 2np5_A | 203 | Transcriptional regulator; TETR family, structural | 83.26 | |
| 2hku_A | 215 | A putative transcriptional regulator; structural g | 83.25 | |
| 2jj7_A | 186 | Hemolysin II regulatory protein; DNA-binding prote | 83.24 | |
| 3g5g_A | 99 | Regulatory protein; transcriptional regulator, hel | 83.2 | |
| 2k9q_A | 77 | Uncharacterized protein; all helix, helix-turn-hel | 83.2 | |
| 2o03_A | 131 | Probable zinc uptake regulation protein FURB; DNA- | 83.16 | |
| 1pb6_A | 212 | Hypothetical transcriptional regulator YCDC; helix | 83.15 | |
| 4ham_A | 134 | LMO2241 protein; structural genomics, PSI-biology, | 83.12 | |
| 1u8b_A | 133 | ADA polyprotein; protein-DNA complex, methylation, | 83.1 | |
| 2eh3_A | 179 | Transcriptional regulator; all alpha proteins, tet | 83.09 | |
| 2wte_A | 244 | CSA3; antiviral protein, viral resistance, winged | 83.08 | |
| 2guh_A | 214 | Putative TETR-family transcriptional regulator; he | 83.08 | |
| 3pas_A | 195 | TETR family transcription regulator; structural ge | 83.07 | |
| 2g7l_A | 243 | TETR-family transcriptional regulator; APC6062, pr | 83.06 | |
| 3onq_A | 262 | Regulator of polyketide synthase expression; struc | 83.05 | |
| 3bdd_A | 142 | Regulatory protein MARR; putative multiple antibio | 83.04 | |
| 2dg7_A | 195 | Putative transcriptional regulator; helix-turn-hel | 83.03 | |
| 2w48_A | 315 | Sorbitol operon regulator; SORC, activator, repres | 83.02 | |
| 3vib_A | 210 | MTRR; helix-turn-helix motif, DNA binding, DNA bin | 83.01 | |
| 3col_A | 196 | Putative transcription regulator; structural genom | 82.94 | |
| 2ia0_A | 171 | Putative HTH-type transcriptional regulator PF086; | 82.91 | |
| 3bja_A | 139 | Transcriptional regulator, MARR family, putative; | 82.89 | |
| 3b73_A | 111 | PHIH1 repressor-like protein; winged-helix-turn-he | 82.88 | |
| 3clo_A | 258 | Transcriptional regulator; NP_811094.1, bacterial | 82.87 | |
| 2vpr_A | 207 | Tetracycline resistance repressor protein; transcr | 82.87 | |
| 3f0c_A | 216 | TETR-molecule A, transcriptional regulator; MCSG,P | 82.83 | |
| 2o7t_A | 199 | Transcriptional regulator; transcription regulator | 82.83 | |
| 3ech_A | 142 | MEXR, multidrug resistance operon repressor; winge | 82.82 | |
| 1sfu_A | 75 | 34L protein; protein/Z-DNA complex, DNA binding pr | 82.79 | |
| 3u1d_A | 151 | Uncharacterized protein; GNTR-superfamily, structu | 82.73 | |
| 2iu5_A | 195 | DHAS, YCEG, HTH-type dhaklm operon transcriptional | 82.72 | |
| 3f6w_A | 83 | XRE-family like protein; helix-turn-helix, DNA bin | 82.69 | |
| 3mvp_A | 217 | TETR/ACRR transcriptional regulator; PSI, MCSG, st | 82.65 | |
| 3bdn_A | 236 | Lambda repressor; repressor, allostery; HET: DNA; | 82.62 | |
| 1mkm_A | 249 | ICLR transcriptional regulator; structural genomic | 82.6 | |
| 1mkm_A | 249 | ICLR transcriptional regulator; structural genomic | 82.6 | |
| 3rd3_A | 197 | Probable transcriptional regulator; 2.40A {Pseudom | 82.54 | |
| 2ijl_A | 135 | AGR_C_4647P, molybdenum-binding transcriptional re | 82.53 | |
| 2hzt_A | 107 | Putative HTH-type transcriptional regulator YTCD; | 82.5 | |
| 3bqy_A | 209 | Putative TETR family transcriptional regulator; st | 82.48 | |
| 3mnl_A | 203 | KSTR, transcriptional regulatory protein (probably | 82.4 | |
| 3cec_A | 104 | Putative antidote protein of plasmid maintenance; | 82.39 | |
| 3dpj_A | 194 | Transcription regulator, TETR family; APC88616, si | 82.39 | |
| 3bni_A | 229 | Putative TETR-family transcriptional regulator; st | 82.39 | |
| 3mlf_A | 111 | Transcriptional regulator; structural genomics, he | 82.37 | |
| 2ek5_A | 129 | Predicted transcriptional regulators; helix-turn-h | 82.34 | |
| 2fa5_A | 162 | Transcriptional regulator MARR/EMRR family; multip | 82.34 | |
| 1t33_A | 224 | Putative transcriptional repressor (TETR/ACRR FAM; | 82.32 | |
| 3s8q_A | 82 | R-M controller protein; protein-DNA complex, helix | 82.31 | |
| 1mzb_A | 136 | Ferric uptake regulation protein; ferric uptake re | 82.31 | |
| 1rp3_A | 239 | RNA polymerase sigma factor sigma-28 (FLIA); trans | 82.27 | |
| 2fjr_A | 189 | Repressor protein CI; genetic switch, regulation, | 82.18 | |
| 2q24_A | 194 | Putative TETR family transcriptional regulator; st | 82.15 | |
| 3bru_A | 222 | Regulatory protein, TETR family; structural genomi | 82.12 | |
| 2gen_A | 197 | Probable transcriptional regulator; APC6095, TETR | 82.11 | |
| 1u8b_A | 133 | ADA polyprotein; protein-DNA complex, methylation, | 82.11 | |
| 2eby_A | 113 | Putative HTH-type transcriptional regulator YBAQ; | 82.11 | |
| 1x57_A | 91 | Endothelial differentiation-related factor 1; HMBF | 82.08 | |
| 2fq4_A | 192 | Transcriptional regulator, TETR family; DNA-bindin | 82.08 | |
| 2q0o_A | 236 | Probable transcriptional activator protein TRAR; h | 82.05 | |
| 1z7u_A | 112 | Hypothetical protein EF0647; winged-helix-turn-hel | 82.03 | |
| 2rdp_A | 150 | Putative transcriptional regulator MARR; PFAM PF01 | 82.02 | |
| 2ict_A | 94 | Antitoxin HIGA; helix-turn-helix, structural genom | 82.01 | |
| 3anp_C | 204 | Transcriptional repressor, TETR family; all alpha | 82.0 | |
| 2q0o_A | 236 | Probable transcriptional activator protein TRAR; h | 81.85 | |
| 3vk0_A | 114 | NHTF, transcriptional regulator; HTH motif, XRE tr | 81.81 | |
| 3kkc_A | 177 | TETR family transcriptional regulator; APC20805, s | 81.68 | |
| 2fe3_A | 145 | Peroxide operon regulator; oxidative stress regula | 81.67 | |
| 3nnr_A | 228 | Transcriptional regulator, TETR family; TETR-famil | 81.64 | |
| 3frq_A | 195 | Repressor protein MPHR(A); macrolide antibiotic. r | 81.57 | |
| 3by6_A | 126 | Predicted transcriptional regulator; structural ge | 81.54 | |
| 3fmy_A | 73 | HTH-type transcriptional regulator MQSA (YGIT/B302 | 81.52 | |
| 3knw_A | 212 | Putative transcriptional regulator (TETR/ACRR FAM; | 81.47 | |
| 2xdn_A | 210 | HTH-type transcriptional regulator TTGR; transcrip | 81.47 | |
| 2fbi_A | 142 | Probable transcriptional regulator; MARR, APC5816, | 81.45 | |
| 3trb_A | 104 | Virulence-associated protein I; mobIle and extrach | 81.44 | |
| 3hrs_A | 214 | Metalloregulator SCAR; DTXR/MNTR family member, tr | 81.44 | |
| 3qkx_A | 188 | Uncharacterized HTH-type transcriptional regulato; | 81.42 | |
| 2id3_A | 225 | Putative transcriptional regulator; structural gen | 81.4 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 81.38 | |
| 2gxg_A | 146 | 146AA long hypothetical transcriptional regulator; | 81.36 | |
| 3m8j_A | 111 | FOCB protein; all-alpha, helix-turn-helix, transcr | 81.31 | |
| 1lmb_3 | 92 | Protein (lambda repressor); protein-DNA complex, d | 81.27 | |
| 2ibd_A | 204 | Possible transcriptional regulator; probable trans | 81.19 | |
| 3tgn_A | 146 | ADC operon repressor ADCR; helix-turn-helix, trans | 81.14 | |
| 1j1v_A | 94 | Chromosomal replication initiator protein DNAA, 5' | 81.14 | |
| 3cwr_A | 208 | Transcriptional regulator, TETR family; YP_425770. | 81.11 | |
| 3g3z_A | 145 | NMB1585, transcriptional regulator, MARR family; t | 81.11 | |
| 3sqn_A | 485 | Conserved domain protein; structural genomics, PSI | 81.09 | |
| 2zb9_A | 214 | Putative transcriptional regulator; transcription | 81.09 | |
| 3rh2_A | 212 | Hypothetical TETR-like transcriptional regulator; | 81.07 | |
| 3b81_A | 203 | Transcriptional regulator, ACRR family; NP_350189. | 81.06 | |
| 2f07_A | 197 | YVDT; helix-turn-helix, transcription; HET: BTB; 2 | 80.99 | |
| 2pg4_A | 95 | Uncharacterized protein; structural genomics, join | 80.98 | |
| 3s5r_A | 216 | Transcriptional regulator TETR family; DNA/RNA-bin | 80.95 | |
| 3k0l_A | 162 | Repressor protein; helix-turn-helix, structural ge | 80.84 | |
| 1jgs_A | 138 | Multiple antibiotic resistance protein MARR; trans | 80.8 |
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
Probab=99.38 E-value=9.1e-12 Score=96.83 Aligned_cols=99 Identities=8% Similarity=-0.069 Sum_probs=81.8
Q ss_pred cCCCCCCCHHHHHHHHHHHHcCCCCHHHHHHHhCCChHHHHHHHHHhCCcccCCCCCCCCCCCHHHHHHHHHHHHhCCCc
Q psy17316 113 YGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNASPTAWKPEDLEIALEGIRSGQTT 192 (229)
Q Consensus 113 ~G~~~kYs~e~k~~AV~~~~~g~~S~~~~a~k~gIp~sTL~~~ik~~g~k~~~~~~~~~r~~t~e~r~eaV~~~~~~~~s 192 (229)
+|+++.|+.+++..++.++.+|. |..+||+.+||+.+|+++|++.+.........++++++++++...+++.+.++..+
T Consensus 1 Mgr~~~~s~~~r~~i~~~~~~G~-s~~~ia~~lgis~~Tv~r~~~~~~~~g~~~~~gr~~~l~~~~~~~i~~~~~~~~~s 79 (141)
T 1u78_A 1 MPRGSALSDTERAQLDVMKLLNV-SLHEMSRKISRSRHCIRVYLKDPVSYGTSKRAPRRKALSVRDERNVIRAASNSCKT 79 (141)
T ss_dssp -CCSCCCCHHHHHHHHHHHHTTC-CHHHHHHHHTCCHHHHHHHHHSGGGTTCCCCCCCCCSSCHHHHHHHHHHHHHCCCC
T ss_pred CCCcccCCHHHHHHHHHHHHcCC-CHHHHHHHHCcCHHHHHHHHHcccccCCcCCCCCCCcCCHHHHHHHHHHHhCCCCC
Confidence 36778899999999999997775 99999999999999999999865211111113556788999998898887778899
Q ss_pred HHHHHHHhC--CChHHHHHHHH
Q psy17316 193 VQRASAEYG--IPSGTLYGRCK 212 (229)
Q Consensus 193 ~~eAA~~fg--Vp~~tv~~~vk 212 (229)
+.+++..|| ||++|||+|++
T Consensus 80 ~~~i~~~lg~~~s~~tV~r~l~ 101 (141)
T 1u78_A 80 ARDIRNELQLSASKRTILNVIK 101 (141)
T ss_dssp HHHHHHHTTCCSCHHHHHHHHH
T ss_pred HHHHHHHHCCCccHHHHHHHHH
Confidence 999999999 89999999998
|
| >2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
| >1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A | Back alignment and structure |
|---|
| >1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 | Back alignment and structure |
|---|
| >1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A | Back alignment and structure |
|---|
| >2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 | Back alignment and structure |
|---|
| >1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 | Back alignment and structure |
|---|
| >2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 | Back alignment and structure |
|---|
| >2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 | Back alignment and structure |
|---|
| >2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 | Back alignment and structure |
|---|
| >2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} | Back alignment and structure |
|---|
| >2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} | Back alignment and structure |
|---|
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
| >1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C | Back alignment and structure |
|---|
| >2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3hot_A Transposable element mariner, complete CDS; protein-DNA complex, synaptic complex, transposase, inverted DNA, DNA binding protein-DNA complex; HET: 5IU; 3.25A {Drosophila mauritiana} PDB: 3hos_A* | Back alignment and structure |
|---|
| >1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C | Back alignment and structure |
|---|
| >3hot_A Transposable element mariner, complete CDS; protein-DNA complex, synaptic complex, transposase, inverted DNA, DNA binding protein-DNA complex; HET: 5IU; 3.25A {Drosophila mauritiana} PDB: 3hos_A* | Back alignment and structure |
|---|
| >1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A | Back alignment and structure |
|---|
| >2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 | Back alignment and structure |
|---|
| >1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A | Back alignment and structure |
|---|
| >2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 | Back alignment and structure |
|---|
| >2ao9_A Phage protein; structural genomics, nine-fold NCS., PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.90A {Bacillus cereus} SCOP: a.4.1.17 | Back alignment and structure |
|---|
| >4dyq_A Gene 1 protein; GP1, octamer, DNA-binding, viral protein; 1.50A {Shigella phage SF6} PDB: 4dyc_A 4dyr_A 3hef_A 4dzj_A 4dzp_A | Back alignment and structure |
|---|
| >2ao9_A Phage protein; structural genomics, nine-fold NCS., PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.90A {Bacillus cereus} SCOP: a.4.1.17 | Back alignment and structure |
|---|
| >3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} | Back alignment and structure |
|---|
| >3uj3_X DNA-invertase; helix-turn-helix, site-specific recombinase, recombination; 3.51A {Enterobacteria phage MU} PDB: 3plo_X | Back alignment and structure |
|---|
| >3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} | Back alignment and structure |
|---|
| >3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus} PDB: 4fth_A | Back alignment and structure |
|---|
| >3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1g2h_A Transcriptional regulatory protein TYRR homolog; protein structure, , DNA-binding domain, helix- turn-helix motif; NMR {Haemophilus influenzae} SCOP: a.4.1.12 | Back alignment and structure |
|---|
| >3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >4dyq_A Gene 1 protein; GP1, octamer, DNA-binding, viral protein; 1.50A {Shigella phage SF6} PDB: 4dyc_A 4dyr_A 3hef_A 4dzj_A 4dzp_A | Back alignment and structure |
|---|
| >2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1gdt_A GD resolvase, protein (gamma delta resolvase); protein-DNA complex, double helix, overhanging base, DNA binding protein/DNA complex; 3.00A {Escherichia coli} SCOP: a.4.1.2 c.53.1.1 PDB: 1zr4_A 1zr2_A 2gm4_A 1res_A 1ret_A | Back alignment and structure |
|---|
| >2r0q_C Putative transposon TN552 DNA-invertase BIN3; site-specific recombinase, resolvase, DNA-binding protein, protein-DNA complex, DNA integration, DNA invertase, DNA recombination; 3.20A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} | Back alignment and structure |
|---|
| >1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A | Back alignment and structure |
|---|
| >2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} | Back alignment and structure |
|---|
| >1ntc_A Protein (nitrogen regulation protein (NTRC)); helix-turn-helix, FIS, four-helix bundle, transcription regulation; NMR {Salmonella typhimurium} SCOP: a.4.1.12 | Back alignment and structure |
|---|
| >4ich_A Transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, transcription RE; 1.95A {Saccharomonospora viridis} | Back alignment and structure |
|---|
| >2jml_A DNA binding domain/transcriptional regulator; anti-repressor, MERR, carotenogenesis; HET: DNA; NMR {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1vz0_A PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} SCOP: a.4.14.1 d.268.1.1 | Back alignment and structure |
|---|
| >3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} | Back alignment and structure |
|---|
| >1eto_A FIS, factor for inversion stimulation; transcriptional activation region, DNA-binding protein, transcription activator; 1.90A {Escherichia coli} SCOP: a.4.1.12 PDB: 1etq_A 1ety_A 1fia_A 3fis_A 3iv5_A* 3jr9_A* 3jra_A* 3jrb_A* 3jrc_A* 3jrd_A* 3jre_A* 3jrf_A* 3jrg_A* 3jrh_A* 3jri_A* 1f36_A 1etv_A 1etk_A 1etx_A 1fip_A ... | Back alignment and structure |
|---|
| >2jml_A DNA binding domain/transcriptional regulator; anti-repressor, MERR, carotenogenesis; HET: DNA; NMR {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} | Back alignment and structure |
|---|
| >3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus} PDB: 4fth_A | Back alignment and structure |
|---|
| >1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4fcy_A Transposase; rnaseh, DDE transposase, DNA binding protein-DNA complex; HET: DNA; 3.71A {Enterobacteria phage MU} PDB: 2ezk_A 2ezl_A 2ezh_A 2ezi_A | Back alignment and structure |
|---|
| >2vz4_A Tipal, HTH-type transcriptional activator TIPA; transcription, resistance, antibiotic; 2.90A {Streptomyces lividans} | Back alignment and structure |
|---|
| >3uj3_X DNA-invertase; helix-turn-helix, site-specific recombinase, recombination; 3.51A {Enterobacteria phage MU} PDB: 3plo_X | Back alignment and structure |
|---|
| >1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A | Back alignment and structure |
|---|
| >2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >4fcy_A Transposase; rnaseh, DDE transposase, DNA binding protein-DNA complex; HET: DNA; 3.71A {Enterobacteria phage MU} PDB: 2ezk_A 2ezl_A 2ezh_A 2ezi_A | Back alignment and structure |
|---|
| >1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >1r8d_A Transcription activator MTAN; protein-DNA complex, transcription/DNA complex; 2.70A {Bacillus subtilis} SCOP: a.6.1.3 PDB: 1jbg_A | Back alignment and structure |
|---|
| >1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 | Back alignment and structure |
|---|
| >4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A | Back alignment and structure |
|---|
| >2vz4_A Tipal, HTH-type transcriptional activator TIPA; transcription, resistance, antibiotic; 2.90A {Streptomyces lividans} | Back alignment and structure |
|---|
| >2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >1q06_A Transcriptional regulator CUER; MERR family transcriptional regulator, copper efflux regulator; 2.07A {Escherichia coli} SCOP: a.6.1.3 PDB: 1q05_A 1q07_A | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3gp4_A Transcriptional regulator, MERR family; structural genomics, DNA-BI transcription regulator, PSI-2; 1.85A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1d5y_A ROB transcription factor; protein-DNA complex, DNA, transcription/DNA complex; HET: DNA; 2.70A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 d.60.1.2 | Back alignment and structure |
|---|
| >1r8d_A Transcription activator MTAN; protein-DNA complex, transcription/DNA complex; 2.70A {Bacillus subtilis} SCOP: a.6.1.3 PDB: 1jbg_A | Back alignment and structure |
|---|
| >1ntc_A Protein (nitrogen regulation protein (NTRC)); helix-turn-helix, FIS, four-helix bundle, transcription regulation; NMR {Salmonella typhimurium} SCOP: a.4.1.12 | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >1g2h_A Transcriptional regulatory protein TYRR homolog; protein structure, , DNA-binding domain, helix- turn-helix motif; NMR {Haemophilus influenzae} SCOP: a.4.1.12 | Back alignment and structure |
|---|
| >1j9i_A GPNU1 DBD;, terminase small subunit; DNA binding domain, homodimer, viral assembly, winged helix-turn-helix, viral protein; NMR {Enterobacteria phage lambda} SCOP: a.6.1.5 | Back alignment and structure |
|---|
| >2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* | Back alignment and structure |
|---|
| >1z4h_A TORI, TOR inhibition protein; winged helix, reverse turn, protein binding, DNA binding protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* | Back alignment and structure |
|---|
| >3hh0_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, 11183J, structural genomics; 2.67A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >1q06_A Transcriptional regulator CUER; MERR family transcriptional regulator, copper efflux regulator; 2.07A {Escherichia coli} SCOP: a.6.1.3 PDB: 1q05_A 1q07_A | Back alignment and structure |
|---|
| >3gp4_A Transcriptional regulator, MERR family; structural genomics, DNA-BI transcription regulator, PSI-2; 1.85A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1neq_A DNA-binding protein NER; NMR {Enterobacteria phage MU} SCOP: a.35.1.2 PDB: 1ner_A | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >3hh0_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, 11183J, structural genomics; 2.67A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2hin_A GP39, repressor protein; transcription factor, dimer interface, helix-turn-helix; 1.05A {Enterobacteria phage N15} PDB: 3qws_A | Back alignment and structure |
|---|
| >2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3gpv_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.90A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A | Back alignment and structure |
|---|
| >2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3gpv_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.90A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* | Back alignment and structure |
|---|
| >1z4h_A TORI, TOR inhibition protein; winged helix, reverse turn, protein binding, DNA binding protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2vxz_A Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Pyrobaculum spherical virus} | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A | Back alignment and structure |
|---|
| >2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >2zhg_A Redox-sensitive transcriptional activator SOXR; oxidative stress, MERR family, activator; HET: DNA; 2.80A {Escherichia coli} PDB: 2zhh_A | Back alignment and structure |
|---|
| >1gdt_A GD resolvase, protein (gamma delta resolvase); protein-DNA complex, double helix, overhanging base, DNA binding protein/DNA complex; 3.00A {Escherichia coli} SCOP: a.4.1.2 c.53.1.1 PDB: 1zr4_A 1zr2_A 2gm4_A 1res_A 1ret_A | Back alignment and structure |
|---|
| >3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1eto_A FIS, factor for inversion stimulation; transcriptional activation region, DNA-binding protein, transcription activator; 1.90A {Escherichia coli} SCOP: a.4.1.12 PDB: 1etq_A 1ety_A 1fia_A 3fis_A 3iv5_A* 3jr9_A* 3jra_A* 3jrb_A* 3jrc_A* 3jrd_A* 3jre_A* 3jrf_A* 3jrg_A* 3jrh_A* 3jri_A* 1f36_A 1etv_A 1etk_A 1etx_A 1fip_A ... | Back alignment and structure |
|---|
| >1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2r0q_C Putative transposon TN552 DNA-invertase BIN3; site-specific recombinase, resolvase, DNA-binding protein, protein-DNA complex, DNA integration, DNA invertase, DNA recombination; 3.20A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2hin_A GP39, repressor protein; transcription factor, dimer interface, helix-turn-helix; 1.05A {Enterobacteria phage N15} PDB: 3qws_A | Back alignment and structure |
|---|
| >3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2dg6_A Putative transcriptional regulator; winged-helix motif, MERR family, gene regulation; 2.20A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2dg6_A Putative transcriptional regulator; winged-helix motif, MERR family, gene regulation; 2.20A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A | Back alignment and structure |
|---|
| >1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A | Back alignment and structure |
|---|
| >2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1d5y_A ROB transcription factor; protein-DNA complex, DNA, transcription/DNA complex; HET: DNA; 2.70A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 d.60.1.2 | Back alignment and structure |
|---|
| >2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >3m8j_A FOCB protein; all-alpha, helix-turn-helix, transcription; 1.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A | Back alignment and structure |
|---|
| >1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* | Back alignment and structure |
|---|
| >2zhg_A Redox-sensitive transcriptional activator SOXR; oxidative stress, MERR family, activator; HET: DNA; 2.80A {Escherichia coli} PDB: 2zhh_A | Back alignment and structure |
|---|
| >2cw1_A SN4M; lambda CRO fold, de novo protein; NMR {Synthetic} SCOP: k.46.1.1 | Back alignment and structure |
|---|
| >3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A | Back alignment and structure |
|---|
| >3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} | Back alignment and structure |
|---|
| >1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A | Back alignment and structure |
|---|
| >1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1 | Back alignment and structure |
|---|
| >2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* | Back alignment and structure |
|---|
| >3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3qao_A LMO0526 protein, MERR-like transcriptional regulator; structural genomics, the center for structural genomics of I diseases, csgid; 1.87A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A | Back alignment and structure |
|---|
| >2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* | Back alignment and structure |
|---|
| >3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1j9i_A GPNU1 DBD;, terminase small subunit; DNA binding domain, homodimer, viral assembly, winged helix-turn-helix, viral protein; NMR {Enterobacteria phage lambda} SCOP: a.6.1.5 | Back alignment and structure |
|---|
| >2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A | Back alignment and structure |
|---|
| >3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 | Back alignment and structure |
|---|
| >1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 | Back alignment and structure |
|---|
| >2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A | Back alignment and structure |
|---|
| >3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A | Back alignment and structure |
|---|
| >1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* | Back alignment and structure |
|---|
| >3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A | Back alignment and structure |
|---|
| >3qao_A LMO0526 protein, MERR-like transcriptional regulator; structural genomics, the center for structural genomics of I diseases, csgid; 1.87A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* | Back alignment and structure |
|---|
| >2l8n_A Transcriptional repressor CYTR; bacterial gene repressor, helix turn helix binding domain, L family, transcription regulation, binding protein; NMR {Escherichia coli} PDB: 2lcv_A | Back alignment and structure |
|---|
| >1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2ofy_A Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PS protein structure initiative; 1.70A {Rhodococcus SP} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* | Back alignment and structure |
|---|
| >1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A | Back alignment and structure |
|---|
| >3trb_A Virulence-associated protein I; mobIle and extrachromosomal element functions, DNA binding P; 2.00A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >2ovg_A Phage lambda CRO; transcription factor, helix-turn-helix, bacteriophage, flexi transcription; 1.35A {Enterobacteria phage lambda} PDB: 2ecs_A 1cop_D 4cro_A* 5cro_O 1orc_A 2orc_A 2a63_A 1d1l_A 6cro_A* 3orc_A* 1d1m_B | Back alignment and structure |
|---|
| >3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} | Back alignment and structure |
|---|
| >1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A | Back alignment and structure |
|---|
| >2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} | Back alignment and structure |
|---|
| >3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A | Back alignment and structure |
|---|
| >2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A | Back alignment and structure |
|---|
| >2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1neq_A DNA-binding protein NER; NMR {Enterobacteria phage MU} SCOP: a.35.1.2 PDB: 1ner_A | Back alignment and structure |
|---|
| >3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* | Back alignment and structure |
|---|
| >2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A | Back alignment and structure |
|---|
| >2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 | Back alignment and structure |
|---|
| >2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 | Back alignment and structure |
|---|
| >2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L | Back alignment and structure |
|---|
| >3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A | Back alignment and structure |
|---|
| >1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 | Back alignment and structure |
|---|
| >4g6q_A Putative uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.08A {Kribbella flavida} | Back alignment and structure |
|---|
| >1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >3iwf_A Transcription regulator RPIR family; transcriptional, N-terminal, PSI, MCSG, structural genomics, midwest center structural genomics; 1.40A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A | Back alignment and structure |
|---|
| >2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A | Back alignment and structure |
|---|
| >3ppb_A Putative TETR family transcription regulator; DNA-binding, helix-turn-helix motif, HTH motif, DNA/RNA-BIND helical bundle fold; HET: MSE PG4; 2.10A {Shewanella loihica} | Back alignment and structure |
|---|
| >1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 | Back alignment and structure |
|---|
| >2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} | Back alignment and structure |
|---|
| >2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 | Back alignment and structure |
|---|
| >1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A | Back alignment and structure |
|---|
| >2qko_A Possible transcriptional regulator, TETR family P; TETR family protein, structural genomics, P protein structure initiative; 2.35A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* | Back alignment and structure |
|---|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* | Back alignment and structure |
|---|
| >2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2cw1_A SN4M; lambda CRO fold, de novo protein; NMR {Synthetic} SCOP: k.46.1.1 | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2opt_A Actii protein; helical protein, TETR family, APO-protein, transcriptional R transcription; 2.05A {Streptomyces coelicolor} PDB: 3b6a_A* 3b6c_A* | Back alignment and structure |
|---|
| >3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A | Back alignment and structure |
|---|
| >2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L | Back alignment and structure |
|---|
| >2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >3dcf_A Transcriptional regulator of the TETR/ACRR family; YP_290855.1, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermobifida fusca YX} | Back alignment and structure |
|---|
| >3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli} SCOP: a.35.1.3 PDB: 2icp_A | Back alignment and structure |
|---|
| >3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} | Back alignment and structure |
|---|
| >2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3qkx_A Uncharacterized HTH-type transcriptional regulato; structural genomics, joint center for structural genomics; HET: MSE; 2.35A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3nxc_A HTH-type protein SLMA; nucleoid occlusion, cell division, TETR family member, DNA B protein; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution, transcription; 1.40A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 | Back alignment and structure |
|---|
| >3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B | Back alignment and structure |
|---|
| >1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} | Back alignment and structure |
|---|
| >2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A | Back alignment and structure |
|---|
| >2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* | Back alignment and structure |
|---|
| >1r8e_A Multidrug-efflux transporter regulator; protein-DNA complex, MERR-family transcription activator, MU binding protein; HET: P4P; 2.40A {Bacillus subtilis} SCOP: a.6.1.3 d.60.1.1 PDB: 1exi_A* 1exj_A* 3iao_A 3q5p_A* 3d71_A* 3q3d_A* 3q1m_A* 3q2y_A* 3q5r_A* 3q5s_A* 3d70_A 3d6z_A* 3d6y_A* 1bow_A 2bow_A* | Back alignment and structure |
|---|
| >2yve_A Transcriptional regulator; helix-turn-helix, TETR-family; HET: MBT; 1.40A {Corynebacterium glutamicum} PDB: 1v7b_A 2zoy_A 2yvh_A 2dh0_A* 2zoz_A* | Back alignment and structure |
|---|
| >3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* | Back alignment and structure |
|---|
| >2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} | Back alignment and structure |
|---|
| >3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2g7g_A RHA04620, putative transcriptional regulator; helix-turn-helix, structural genomics, PSI, protein structur initiative; 2.01A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A | Back alignment and structure |
|---|
| >2hxi_A Putative transcriptional regulator; structural genomics, APC6293, TET streptomyces coelicolor A3(2), PSI-2; 1.70A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A | Back alignment and structure |
|---|
| >2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* | Back alignment and structure |
|---|
| >3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomic binding; 1.80A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >4hku_A LMO2814 protein, TETR transcriptional regulator; structural genomics, PSI-biology; 2.30A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} | Back alignment and structure |
|---|
| >2l8n_A Transcriptional repressor CYTR; bacterial gene repressor, helix turn helix binding domain, L family, transcription regulation, binding protein; NMR {Escherichia coli} PDB: 2lcv_A | Back alignment and structure |
|---|
| >2pz9_A Putative regulatory protein; structural genomics, transcriptional regulator, PSI, protein structure initiative; 2.80A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >1sgm_A Putative HTH-type transcriptional regulator YXAF; structural genomics, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3dew_A Transcriptional regulator, TETR family; S genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.75A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B | Back alignment and structure |
|---|
| >2xpw_A Tetracycline repressor protein class D; transcription, transcription regulator, helix-turn-helix, ME coordination; HET: OTC MES; 1.44A {Escherichia coli} PDB: 1bjy_A* 1bj0_A 1du7_A* 1ork_A* 2fj1_A* 1bjz_A* 2o7o_A* 2x6o_A* 2x9d_A* 2xps_A* 2xpt_A* 2vke_A* 2xpu_A* 2xpv_A* 2tct_A* 2xb5_A* 2trt_A* 2xrl_A* 1qpi_A* 1a6i_A ... | Back alignment and structure |
|---|
| >2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 | Back alignment and structure |
|---|
| >2ev1_A Hypothetical protein RV1264/MT1302; alpha-helical, regulatory domain of adenylyl cyclase, oleic lyase; HET: OLA 1PE; 1.60A {Mycobacterium tuberculosis} PDB: 2ev2_A* 2ev3_A* 2ev4_A* | Back alignment and structure |
|---|
| >1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 | Back alignment and structure |
|---|
| >3fiw_A Putative TETR-family transcriptional regulator; TETR-family transcriptional regulator streptomyces, structur genomics, PSI-2; 2.20A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} | Back alignment and structure |
|---|
| >1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A | Back alignment and structure |
|---|
| >3egq_A TETR family transcriptional regulator; DNA-binding, transcription regulation, bacterial regulatory DNA/RNA-binding 3-helical bundle fold; HET: MSE PE8; 2.55A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3lfp_A CSP231I C protein; transcriptional regulator, DNA binding protein, helix-turn-H restriction-modification, transcription; 2.00A {Citrobacter SP} PDB: 3lis_A | Back alignment and structure |
|---|
| >1zk8_A Transcriptional regulator, TETR family; TETR member,transcriptional regulator, STRU genomics, PSI, protein structure initiative; 2.15A {Bacillus cereus atcc 14579} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >2dg7_A Putative transcriptional regulator; helix-turn-helix motif, TETR family, gene regulation; 2.30A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >1r8e_A Multidrug-efflux transporter regulator; protein-DNA complex, MERR-family transcription activator, MU binding protein; HET: P4P; 2.40A {Bacillus subtilis} SCOP: a.6.1.3 d.60.1.1 PDB: 1exi_A* 1exj_A* 3iao_A 3q5p_A* 3d71_A* 3q3d_A* 3q1m_A* 3q2y_A* 3q5r_A* 3q5s_A* 3d70_A 3d6z_A* 3d6y_A* 1bow_A 2bow_A* | Back alignment and structure |
|---|
| >2qwt_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium vanbaalenii pyr-1} | Back alignment and structure |
|---|
| >3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3iuo_A ATP-dependent DNA helicase RECQ; C-terminal, GI PSI, MCSG, structural genomics, midwest center for structur genomics; 1.60A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3kz9_A SMCR; transcriptional regulator, quorum S DNA-binding, transcription regulation, transcription regula; HET: MSE; 2.10A {Vibrio vulnificus} PDB: 2pbx_A | Back alignment and structure |
|---|
| >3bqz_B HTH-type transcriptional regulator QACR; multidrug resistance, TETR, malachite green, DNA- binding, plasmid, repressor; HET: MGR; 2.17A {Staphylococcus aureus} PDB: 3br1_B* 3br3_B* 3pm1_B* 1rkw_B* 1jt0_A* 1jty_B* 1jum_B* 1jup_B* 1jtx_B* 1jus_B* 2dtz_B 2gby_B* 2hq5_B 3br2_B* 3br5_B* 1qvt_B* 1qvu_B* 3br0_B* 3br6_B* 1jt6_B* ... | Back alignment and structure |
|---|
| >2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A | Back alignment and structure |
|---|
| >3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution, transcription; 1.40A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >4ghj_A Probable transcriptional regulator; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE; 1.75A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2fq4_A Transcriptional regulator, TETR family; DNA-binding protein, bacillu structural genomics, PSI, protein structure initiative; 1.79A {Bacillus cereus} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A | Back alignment and structure |
|---|
| >3gzi_A Transcriptional regulator, TETR family; TETR family transcriptional regulator, structural genomics, center for structural genomics, JCSG; 2.05A {Shewanella loihica pv-4} | Back alignment and structure |
|---|
| >1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A | Back alignment and structure |
|---|
| >3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 | Back alignment and structure |
|---|
| >2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* | Back alignment and structure |
|---|
| >1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 3jso_A* 3jsp_A* 3k3r_E* 1jhc_A 1jhe_A 1lea_A 1leb_A | Back alignment and structure |
|---|
| >3vp5_A Transcriptional regulator; heme, sensor protein, TETR superf transcription; HET: HEM; 1.90A {Lactococcus lactis} PDB: 3vox_A 3vok_A* | Back alignment and structure |
|---|
| >3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2rae_A Transcriptional regulator, ACRR family protein; TETR/ACRR family transcriptional regulator, structural genom 2, RHA08332, MCSG; 2.20A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3f1b_A TETR-like transcriptional regulator; APC5888, rhodococcus SP. RHA1, structural genomics, PS protein structure initiative; 2.40A {Rhodococcus} | Back alignment and structure |
|---|
| >4ac0_A Tetracycline repressor protein class B from trans TN1 0; transcription; HET: MIY; 2.45A {Escherichia coli} | Back alignment and structure |
|---|
| >1z0x_A Transcriptional regulator, TETR family; structural genomics, PSI, P structure initiative; 2.40A {Enterococcus faecalis} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >1vz0_A PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} SCOP: a.4.14.1 d.268.1.1 | Back alignment and structure |
|---|
| >3lwj_A Putative TETR-family transcriptional regulator; structural G joint center for structural genomics, JCSG, protein structu initiative; 2.07A {Syntrophomonas wolfei subsp} | Back alignment and structure |
|---|
| >3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3lhq_A Acrab operon repressor (TETR/ACRR family); structural genomics, IDP02616, csgid, DNA-binding, transcription, transcription regulation; 1.56A {Salmonella enterica subsp} PDB: 3bcg_A 2qop_A | Back alignment and structure |
|---|
| >3ljl_A Transcriptional regulator LUXT; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 3.20A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2zcm_A Biofilm operon icaabcd HTH-type negative transcri regulator ICAR; helix-turn-helix, TETR family, repressor; 1.33A {Staphylococcus epidermidis} PDB: 2zcn_A | Back alignment and structure |
|---|
| >2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} | Back alignment and structure |
|---|
| >1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 | Back alignment and structure |
|---|
| >2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} | Back alignment and structure |
|---|
| >4aci_A HTH-type transcriptional repressor ACNR; aconitase, citrate, TETR superfamily; HET: CIT; 1.65A {Corynebacterium glutamicum} PDB: 4ac6_A* | Back alignment and structure |
|---|
| >2qtq_A Transcriptional regulator, TETR family; transcription regulator, DNA/RNA-binding 3-helical bundle FO turn helix motif, HTH motif; HET: MSE; 1.85A {Novosphingobium aromaticivorans} PDB: 2rha_A* | Back alignment and structure |
|---|
| >3vpr_A Transcriptional regulator, TETR family; all alpha, helix-turn-helix, transcriptional repressor, DNA protein; 2.27A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3on4_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: MSE; 1.85A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1y6u_A XIS, excisionase from transposon TN916; structure, DNA architectural protein, tyrosine recombinase, winged-helix protein; NMR {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3o60_A LIN0861 protein; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative, unknown function; 2.80A {Listeria innocua} | Back alignment and structure |
|---|
| >2hxo_A Putative TETR-family transcriptional regulator; TETR transcriptional regulator, structural genomics, PSI-2, structure initiative; 2.40A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2g7s_A Transcriptional regulator, TETR family; APC5906, PSI, protein structure initiat midwest center for structural genomics, MCSG; HET: MSE; 1.40A {Agrobacterium tumefaciens str} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2dg8_A Putative TETR-family transcriptional regulatory P; helix-turn-helix motif, gene regulation; 2.21A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2d6y_A Putative TETR family regulatory protein; helix-turn-helix, gene regulation; HET: TLA; 2.30A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3bjb_A Probable transcriptional regulator, TETR family P; APC7331, rhodococcus SP. RHA1, structural genomics, PS protein structure initiative; 2.50A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2np5_A Transcriptional regulator; TETR family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE LMT NDS; 1.80A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2hku_A A putative transcriptional regulator; structural genomics, APC6040, TET rhodococcus SP. RHA1, PSI-2, protein structure initiative; HET: PG4; 2.00A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2jj7_A Hemolysin II regulatory protein; DNA-binding protein, transcription regulation, DNA-binding, family, transcription, transcriptional regulator; 2.10A {Bacillus cereus} PDB: 2wv1_A 2jk3_A 2fx0_A | Back alignment and structure |
|---|
| >3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A | Back alignment and structure |
|---|
| >2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1pb6_A Hypothetical transcriptional regulator YCDC; helix-loop-helix, dimer, structural genomics, PSI, protein structure initiative; 2.50A {Escherichia coli} PDB: 3loc_A* | Back alignment and structure |
|---|
| >4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1u8b_A ADA polyprotein; protein-DNA complex, methylation, zinc, helix-turn-helix, metal binding protein/DNA complex; 2.10A {Escherichia coli} PDB: 1zgw_A* 1wpk_A* 1adn_A 1eyf_A | Back alignment and structure |
|---|
| >2eh3_A Transcriptional regulator; all alpha proteins, tetracyclin repressor-like, C-terminal D homeodomain-like, DNA/RNA-binding 3-helical bundle; 1.55A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2guh_A Putative TETR-family transcriptional regulator; helix-turn-helix, TETR fold, structural genomics, PSI, prote structure initiative; HET: MSE; 1.52A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3pas_A TETR family transcription regulator; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.90A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >2g7l_A TETR-family transcriptional regulator; APC6062, protein structure initiativ midwest center for structural genomics, MCSG; 2.10A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3onq_A Regulator of polyketide synthase expression; structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Bifidobacterium adolescentis} | Back alignment and structure |
|---|
| >3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} | Back alignment and structure |
|---|
| >2dg7_A Putative transcriptional regulator; helix-turn-helix motif, TETR family, gene regulation; 2.30A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3vib_A MTRR; helix-turn-helix motif, DNA binding, DNA binding protein; HET: CXS; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3col_A Putative transcription regulator; structural genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} | Back alignment and structure |
|---|
| >3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >2vpr_A Tetracycline resistance repressor protein; transcription, metal-binding, antibiotic resistance, transcr regulator; HET: TDC; 2.49A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3f0c_A TETR-molecule A, transcriptional regulator; MCSG,PSI, SAD, structural genomics, protein structure initiative; 2.96A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2o7t_A Transcriptional regulator; transcription regulator, DNA/RNA-binding 3-helical bundle FO turn helix motif, HTH motif; HET: UNL; 2.10A {Corynebacterium glutamicum} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A | Back alignment and structure |
|---|
| >1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} | Back alignment and structure |
|---|
| >2iu5_A DHAS, YCEG, HTH-type dhaklm operon transcriptional activator; synthase, TETR family; 1.6A {Lactococcus lactis subsp} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3mvp_A TETR/ACRR transcriptional regulator; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 1.85A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} | Back alignment and structure |
|---|
| >1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 | Back alignment and structure |
|---|
| >1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 | Back alignment and structure |
|---|
| >3rd3_A Probable transcriptional regulator; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2ijl_A AGR_C_4647P, molybdenum-binding transcriptional repressor; structural GE DNA-binding protein, PSI-2, PROT structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >3bqy_A Putative TETR family transcriptional regulator; structural genomics, strept coelicolor, PSI-2, protein structure initiative; 1.95A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3mnl_A KSTR, transcriptional regulatory protein (probably TETR; TETR family of transcriptional regulator, all-helical; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3cec_A Putative antidote protein of plasmid maintenance; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.60A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3dpj_A Transcription regulator, TETR family; APC88616, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MES; 1.90A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3bni_A Putative TETR-family transcriptional regulator; structural genomics, APC7281; HET: PG4; 2.30A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A | Back alignment and structure |
|---|
| >2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1t33_A Putative transcriptional repressor (TETR/ACRR FAM; structural genomics, TETR/CCRR FA helix turn helix DNA binding domain, PSI; 2.20A {Salmonella typhimurium} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* | Back alignment and structure |
|---|
| >1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 | Back alignment and structure |
|---|
| >1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A | Back alignment and structure |
|---|
| >2fjr_A Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A | Back alignment and structure |
|---|
| >2q24_A Putative TETR family transcriptional regulator; structural genomics, PSI, protein structure initiative; 1.80A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3bru_A Regulatory protein, TETR family; structural genomics, APC88928, PSI-2, protein structur initiative; 2.30A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2gen_A Probable transcriptional regulator; APC6095, TETR family, structural genomics, PSI, protein structure initiative; 1.70A {Pseudomonas aeruginosa PAO1} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >1u8b_A ADA polyprotein; protein-DNA complex, methylation, zinc, helix-turn-helix, metal binding protein/DNA complex; 2.10A {Escherichia coli} PDB: 1zgw_A* 1wpk_A* 1adn_A 1eyf_A | Back alignment and structure |
|---|
| >2eby_A Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 | Back alignment and structure |
|---|
| >2fq4_A Transcriptional regulator, TETR family; DNA-binding protein, bacillu structural genomics, PSI, protein structure initiative; 1.79A {Bacillus cereus} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} | Back alignment and structure |
|---|
| >1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli} SCOP: a.35.1.3 PDB: 2icp_A | Back alignment and structure |
|---|
| >3anp_C Transcriptional repressor, TETR family; all alpha protein, DNA, acyl-COA; HET: DCC DAO; 1.95A {Thermus thermophilus} PDB: 3ang_C* | Back alignment and structure |
|---|
| >2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} | Back alignment and structure |
|---|
| >3vk0_A NHTF, transcriptional regulator; HTH motif, XRE transcription factor, DNA binding protein; 1.88A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3kkc_A TETR family transcriptional regulator; APC20805, structural genomics, PSI-2, protein structure initiative; 2.50A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* | Back alignment and structure |
|---|
| >3nnr_A Transcriptional regulator, TETR family; TETR-family transcriptional regulator, structural genomics, center for structural genomics, JCSG; HET: MSE; 2.49A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3frq_A Repressor protein MPHR(A); macrolide antibiotic. repressor, biosensor, erythromycin, STRPTOMYCES, natural products, biosynthesis, DNA-binding; HET: ERY; 1.76A {Escherichia coli} PDB: 3g56_A | Back alignment and structure |
|---|
| >3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3knw_A Putative transcriptional regulator (TETR/ACRR FAM; TETR-like protein, MCSG, PSI, structural genomics, protein S initiative; 2.45A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2xdn_A HTH-type transcriptional regulator TTGR; transcription regulation, TETR family; 2.20A {Pseudomonas putida} PDB: 2uxu_A* 2uxi_A* 2uxo_A* 2uxp_A* 2uxh_A* | Back alignment and structure |
|---|
| >2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3trb_A Virulence-associated protein I; mobIle and extrachromosomal element functions, DNA binding P; 2.00A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A | Back alignment and structure |
|---|
| >3qkx_A Uncharacterized HTH-type transcriptional regulato; structural genomics, joint center for structural genomics; HET: MSE; 2.35A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2id3_A Putative transcriptional regulator; structural genomics, PSI-2, prote structure initiative; 1.70A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A | Back alignment and structure |
|---|
| >3m8j_A FOCB protein; all-alpha, helix-turn-helix, transcription; 1.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* | Back alignment and structure |
|---|
| >2ibd_A Possible transcriptional regulator; probable transcriptional regulatory protein, rhodococcus SP. structural genomics, PSI-2; 1.50A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1j1v_A Chromosomal replication initiator protein DNAA, 5'-D(*CP*CP*TP*GP*TP*GP*GP*AP*TP*AP*AP*CP*A)-3'; protein-DNA complex; 2.10A {Escherichia coli} SCOP: a.4.12.2 | Back alignment and structure |
|---|
| >3cwr_A Transcriptional regulator, TETR family; YP_425770.1, transcriptional regulator of TETR family, bacterial regulatory proteins; 1.50A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3sqn_A Conserved domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MGA family; 2.31A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2zb9_A Putative transcriptional regulator; transcription regulator, TETR family, helix-turn-helix, DNA- binding, transcription regulation; 2.25A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3rh2_A Hypothetical TETR-like transcriptional regulator; DNA/RNA-binding 3-helical bundle, structural genomics, joint for structural genomics; 2.42A {Shewanella amazonensis} | Back alignment and structure |
|---|
| >3b81_A Transcriptional regulator, ACRR family; NP_350189.1, predicted DNA-binding transcriptional regulator TETR/ACRR family; 2.10A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >2f07_A YVDT; helix-turn-helix, transcription; HET: BTB; 2.30A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >3s5r_A Transcriptional regulator TETR family; DNA/RNA-binding 3-helical bundle, tetracyclin repressor-like structural genomics; 2.60A {Syntrophus aciditrophicus} | Back alignment and structure |
|---|
| >3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} | Back alignment and structure |
|---|
| >1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 229 | ||||
| d2coba1 | 63 | a.4.1.15 (A:8-70) Ligand-dependent corepressor (LC | 8e-05 | |
| d2coba1 | 63 | a.4.1.15 (A:8-70) Ligand-dependent corepressor (LC | 3e-04 |
| >d2coba1 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LCoR) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Psq domain domain: Ligand-dependent corepressor (LCoR) species: Human (Homo sapiens) [TaxId: 9606]
Score = 37.7 bits (87), Expect = 8e-05
Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 2/55 (3%)
Query: 31 KTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTL-WQRAHRLG-IHTPKKEGP 83
+ + E ++ A+ + +G+MS++KA YGIP +TL ++ RLG + P K+
Sbjct: 5 RQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKM 59
|
| >d2coba1 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LCoR) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| d2jn6a1 | 89 | Uncharacterized protein Cgl2762 {Corynebacterium g | 98.84 | |
| d2jn6a1 | 89 | Uncharacterized protein Cgl2762 {Corynebacterium g | 98.76 | |
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 98.46 | |
| d1pdnc_ | 123 | Paired protein (prd) {Fruit fly (Drosophila melano | 98.44 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 98.29 | |
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 98.27 | |
| d1pdnc_ | 123 | Paired protein (prd) {Fruit fly (Drosophila melano | 98.17 | |
| d2coba1 | 63 | Ligand-dependent corepressor (LCoR) {Human (Homo s | 98.11 | |
| d1k78a1 | 63 | Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | 98.11 | |
| d2coba1 | 63 | Ligand-dependent corepressor (LCoR) {Human (Homo s | 98.06 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 97.98 | |
| d1k78a1 | 63 | Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | 97.93 | |
| d1umqa_ | 60 | Photosynthetic apparatus regulatory protein PprA ( | 97.68 | |
| d2oa4a1 | 93 | Uncharacterized protein SPO1678 {Silicibacter pome | 97.56 | |
| d1g2ha_ | 61 | Transcriptional regulator TyrR, C-terminal domain | 97.37 | |
| d1vz0a1 | 93 | Putative partitioning protein ParB/Spo0J {Thermus | 97.0 | |
| d1etxa_ | 89 | FIS protein {Escherichia coli [TaxId: 562]} | 96.92 | |
| d2oa4a1 | 93 | Uncharacterized protein SPO1678 {Silicibacter pome | 96.8 | |
| d1ntca_ | 91 | DNA-binding domain of NTRC {Salmonella typhimurium | 96.79 | |
| d1umqa_ | 60 | Photosynthetic apparatus regulatory protein PprA ( | 96.52 | |
| d1gdta1 | 43 | gamma,delta resolvase (C-terminal domain) {Escheri | 96.45 | |
| d1g2ha_ | 61 | Transcriptional regulator TyrR, C-terminal domain | 96.21 | |
| d1gdta1 | 43 | gamma,delta resolvase (C-terminal domain) {Escheri | 95.93 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 95.79 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 95.22 | |
| d1q06a_ | 127 | Transcriptional regulator CueR {Escherichia coli [ | 95.09 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 95.08 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 95.04 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 94.9 | |
| d1r8da_ | 109 | Multidrug transporter activator MtaN {Bacillus sub | 94.89 | |
| d1q06a_ | 127 | Transcriptional regulator CueR {Escherichia coli [ | 94.86 | |
| d1rp3a2 | 71 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 94.79 | |
| d1r1ta_ | 98 | SmtB repressor {Cyanobacteria (Synechococcus), pcc | 94.65 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 94.55 | |
| d1r1ua_ | 94 | Metal-sensing transcriptional repressor CzrA {Stap | 94.46 | |
| d1r8da_ | 109 | Multidrug transporter activator MtaN {Bacillus sub | 94.44 | |
| d1rp3a2 | 71 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 94.44 | |
| d1utxa_ | 66 | Putative transcription regulator CylR2 {Enterococc | 94.42 | |
| d2b5aa1 | 77 | Regulatory protein C.BclI {Bacillus caldolyticus [ | 94.38 | |
| d1etxa_ | 89 | FIS protein {Escherichia coli [TaxId: 562]} | 94.35 | |
| d1jhga_ | 101 | Trp repressor, TrpR {Escherichia coli [TaxId: 562] | 94.15 | |
| d1or7a1 | 68 | SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 | 94.14 | |
| d2p4wa1 | 194 | Transcriptional regulatory protein PF1790 {Pyrococ | 93.79 | |
| d1r8ea1 | 118 | Transcription activator BmrR {Bacillus subtilis [T | 93.74 | |
| d1jhga_ | 101 | Trp repressor, TrpR {Escherichia coli [TaxId: 562] | 93.71 | |
| d1r8ea1 | 118 | Transcription activator BmrR {Bacillus subtilis [T | 93.51 | |
| d2ppxa1 | 62 | Uncharacterized protein Atu1735 {Agrobacterium tum | 93.49 | |
| d2ezla_ | 99 | Ibeta subdomain of the mu end DNA-binding domain o | 93.47 | |
| d1a04a1 | 67 | Nitrate/nitrite response regulator (NarL) {Escheri | 93.44 | |
| d1ulya_ | 190 | Hypothetical protein PH1932 {Pyrococcus horikoshii | 93.39 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 93.36 | |
| d2croa_ | 65 | cro 434 {Bacteriophage 434 [TaxId: 10712]} | 93.32 | |
| d1r71a_ | 114 | Transcriptional repressor protein KorB DNA-binding | 93.21 | |
| d1or7a1 | 68 | SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 | 93.17 | |
| d2ao9a1 | 120 | Phage protein BC1890 {Bacillus cereus [TaxId: 1396 | 92.87 | |
| d2ezla_ | 99 | Ibeta subdomain of the mu end DNA-binding domain o | 92.85 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 92.82 | |
| d1ntca_ | 91 | DNA-binding domain of NTRC {Salmonella typhimurium | 92.74 | |
| d1z0xa1 | 68 | Transcriptional regulator EF0787 {Enterococcus fae | 92.73 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 92.56 | |
| d2g7la1 | 68 | Putative transcriptional regulator SCO7704 {Strept | 92.52 | |
| d2r1jl1 | 66 | P22 C2 repressor, DNA-binding domain {Salmonella b | 92.51 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 92.48 | |
| d1r69a_ | 63 | 434 C1 repressor, DNA-binding domain {Bacteriophag | 92.48 | |
| d1xsva_ | 106 | Hypothetical protein SAV1236 {Staphylococcus aureu | 92.4 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 92.32 | |
| d1fsea_ | 67 | Germination protein GerE {Bacillus subtilis [TaxId | 92.24 | |
| d2g7ga1 | 65 | Putative transcriptional regulator Rha04620 {Rhodo | 92.24 | |
| d1l3la1 | 65 | Quorum-sensing transcription factor TraR, C-termin | 92.14 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 91.92 | |
| d2o3fa1 | 83 | Putative transcriptional regulator YbbH {Bacillus | 91.85 | |
| d2o38a1 | 89 | Hypothetical protein RPA3824 {Rhodopseudomonas pal | 91.85 | |
| d1s7oa_ | 106 | Hypothetical protein SPy1201 {Streptococcus pyogen | 91.8 | |
| d1a04a1 | 67 | Nitrate/nitrite response regulator (NarL) {Escheri | 91.53 | |
| d2auwa1 | 67 | Hypothetical protein NE0471 C-terminal domain {Nit | 91.49 | |
| d2hsga1 | 57 | Glucose-resistance amylase regulator CcpA, N-termi | 91.43 | |
| d1xsva_ | 106 | Hypothetical protein SAV1236 {Staphylococcus aureu | 91.33 | |
| d2np5a1 | 69 | Transcriptional regulator RHA1_ro04179 {Rhodococcu | 91.27 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 91.24 | |
| d2auwa1 | 67 | Hypothetical protein NE0471 C-terminal domain {Nit | 91.2 | |
| d1l3la1 | 65 | Quorum-sensing transcription factor TraR, C-termin | 91.05 | |
| d1r1ta_ | 98 | SmtB repressor {Cyanobacteria (Synechococcus), pcc | 90.79 | |
| d1bl0a1 | 54 | MarA {Escherichia coli [TaxId: 562]} | 90.64 | |
| d2i10a1 | 69 | Putative transcriptional regulator RHA1_ro09068 {R | 90.62 | |
| d1r1ua_ | 94 | Metal-sensing transcriptional repressor CzrA {Stap | 90.6 | |
| d1yioa1 | 70 | Response regulatory protein StyR, C-terminal domai | 90.58 | |
| d2a6ca1 | 69 | HTH-motif protein NE1354 {Nitrosomonas europaea [T | 90.52 | |
| d1qpza1 | 57 | Purine repressor (PurR), N-terminal domain {Escher | 90.5 | |
| d1s7oa_ | 106 | Hypothetical protein SPy1201 {Streptococcus pyogen | 90.47 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 90.36 | |
| d1y9qa1 | 79 | Probable transcriptional regulator VC1968, N-termi | 90.34 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 90.22 | |
| d1u2wa1 | 108 | Cadmium efflux system accessory protein CadC {Stap | 90.15 | |
| d2fbqa1 | 79 | Transcriptional regulator PsrA {Pseudomonas aerugi | 90.02 | |
| d2a6ca1 | 69 | HTH-motif protein NE1354 {Nitrosomonas europaea [T | 89.94 | |
| d1t56a1 | 73 | Ethr repressor {Mycobacterium tuberculosis [TaxId: | 89.88 | |
| d2o38a1 | 89 | Hypothetical protein RPA3824 {Rhodopseudomonas pal | 89.85 | |
| d2gfna1 | 77 | Probable transcriptional regulator RHA1_ro04631 {R | 89.8 | |
| d1qpza1 | 57 | Purine repressor (PurR), N-terminal domain {Escher | 89.67 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 89.63 | |
| d1efaa1 | 59 | Lac repressor (LacR), N-terminal domain {Escherich | 89.59 | |
| d1b0na2 | 68 | SinR repressor, DNA-binding domain {Bacillus subti | 89.5 | |
| d1jt6a1 | 71 | Multidrug binding protein QacR {Staphylococcus aur | 89.46 | |
| d2icta1 | 87 | Antitoxin HigA {Escherichia coli [TaxId: 562]} | 89.37 | |
| d2iu5a1 | 71 | Transcriptional activator DhaS {Lactococcus lactis | 89.34 | |
| d1uxda_ | 59 | Fructose repressor (FruR), N-terminal domain {Esch | 89.33 | |
| d2gena1 | 70 | Probable transcriptional regulator PA1836 {Pseudom | 89.24 | |
| d1vz0a1 | 93 | Putative partitioning protein ParB/Spo0J {Thermus | 89.13 | |
| d1zk8a1 | 72 | Transcriptional regulator BC5000 {Bacillus cereus | 89.01 | |
| d2fq4a1 | 69 | Transcriptional regulator BC3163 {Bacillus cereus | 89.0 | |
| d2ev0a1 | 61 | Manganese transport regulator MntR {Bacillus subti | 88.91 | |
| d1fsea_ | 67 | Germination protein GerE {Bacillus subtilis [TaxId | 88.85 | |
| d1nera_ | 74 | Ner {Bacteriophage mu [TaxId: 10677]} | 88.8 | |
| d1v7ba1 | 74 | Transcriptional regulator Cgl2612 {Corynebacterium | 88.8 | |
| d2vkva1 | 62 | Tetracyclin repressor (Tet-repressor, TetR) {Esche | 88.76 | |
| d1pb6a1 | 72 | Hypothetical transcriptional regulator YcdC {Esche | 88.75 | |
| d2hkua1 | 70 | Putative transcriptional regulator RHA1_ro03468 {R | 88.73 | |
| d2g7sa1 | 74 | Putative transcriptional regulator Atu0279 {Agroba | 88.66 | |
| d1ui5a1 | 71 | A-factor receptor homolog CprB {Streptomyces coeli | 88.63 | |
| d2hsga1 | 57 | Glucose-resistance amylase regulator CcpA, N-termi | 88.51 | |
| d1y7ya1 | 69 | Restriction-modification controller protein C.AhdI | 88.43 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 88.43 | |
| d1ulya_ | 190 | Hypothetical protein PH1932 {Pyrococcus horikoshii | 88.38 | |
| d3c07a1 | 75 | Putative transcriptional regulator SCO4850 {Strept | 88.25 | |
| d1b0na2 | 68 | SinR repressor, DNA-binding domain {Bacillus subti | 88.08 | |
| d2ppxa1 | 62 | Uncharacterized protein Atu1735 {Agrobacterium tum | 88.07 | |
| d2o7ta1 | 78 | Transcriptional regulator Cgl1640/Cg1846 {Coryneba | 87.96 | |
| d2b5aa1 | 77 | Regulatory protein C.BclI {Bacillus caldolyticus [ | 87.92 | |
| d2i10a1 | 69 | Putative transcriptional regulator RHA1_ro09068 {R | 87.84 | |
| d1yioa1 | 70 | Response regulatory protein StyR, C-terminal domai | 87.78 | |
| d1utxa_ | 66 | Putative transcription regulator CylR2 {Enterococc | 87.76 | |
| d2icta1 | 87 | Antitoxin HigA {Escherichia coli [TaxId: 562]} | 87.67 | |
| d2hoea1 | 62 | N-acetylglucosamine kinase {Thermotoga maritima [T | 87.53 | |
| d2d6ya1 | 68 | Putative regulator SCO4008 {Streptomyces coelicolo | 87.51 | |
| d1sgma1 | 73 | Putative transcriptional regulator YxaF {Bacillus | 87.51 | |
| d1efaa1 | 59 | Lac repressor (LacR), N-terminal domain {Escherich | 87.44 | |
| d1lmb3_ | 87 | lambda C1 repressor, DNA-binding domain {Bacteriop | 87.36 | |
| d2croa_ | 65 | cro 434 {Bacteriophage 434 [TaxId: 10712]} | 87.36 | |
| d2fx0a1 | 73 | Hemolysin II regulatory protein, HlyIIR {Bacillus | 87.21 | |
| d2esna1 | 89 | Probable LysR-type transcriptional regulator PA047 | 87.16 | |
| d2gena1 | 70 | Probable transcriptional regulator PA1836 {Pseudom | 87.11 | |
| d2hoea1 | 62 | N-acetylglucosamine kinase {Thermotoga maritima [T | 87.06 | |
| d1t56a1 | 73 | Ethr repressor {Mycobacterium tuberculosis [TaxId: | 86.99 | |
| d2id3a1 | 68 | Putative transcriptional regulator SCO5951 {Strept | 86.95 | |
| d2p4wa1 | 194 | Transcriptional regulatory protein PF1790 {Pyrococ | 86.88 | |
| d1bl0a2 | 62 | MarA {Escherichia coli [TaxId: 562]} | 86.68 | |
| d1pb6a1 | 72 | Hypothetical transcriptional regulator YcdC {Esche | 86.62 | |
| d1d5ya1 | 54 | Rob transcription factor, N-terminal domain {Esche | 86.51 | |
| d1jt6a1 | 71 | Multidrug binding protein QacR {Staphylococcus aur | 86.23 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 86.19 | |
| d2isya1 | 63 | Iron-dependent regulator IdeR {Mycobacterium tuber | 85.76 | |
| d1r69a_ | 63 | 434 C1 repressor, DNA-binding domain {Bacteriophag | 85.73 | |
| d3c07a1 | 75 | Putative transcriptional regulator SCO4850 {Strept | 85.69 | |
| d2g3ba1 | 72 | Putative transcriptional regulator {Rhodococcus sp | 85.65 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 85.61 | |
| d2ao9a1 | 120 | Phage protein BC1890 {Bacillus cereus [TaxId: 1396 | 85.52 | |
| d1b9ma1 | 127 | N-terminal domain of molybdate-dependent transcrip | 85.48 | |
| d2g7ga1 | 65 | Putative transcriptional regulator Rha04620 {Rhodo | 85.34 | |
| d2o7ta1 | 78 | Transcriptional regulator Cgl1640/Cg1846 {Coryneba | 85.31 | |
| d1p4wa_ | 87 | Transcriptional regulator RcsB {Erwinia amylovora | 85.24 | |
| d2hkua1 | 70 | Putative transcriptional regulator RHA1_ro03468 {R | 85.14 | |
| d2hyja1 | 75 | Putative transcriptional regulator SCO4940 {Strept | 85.14 | |
| d1vi0a1 | 72 | Hypothetical transcriptional regulator YsiA {Bacil | 84.84 | |
| d2r1jl1 | 66 | P22 C2 repressor, DNA-binding domain {Salmonella b | 84.83 | |
| d2gfna1 | 77 | Probable transcriptional regulator RHA1_ro04631 {R | 84.76 | |
| d1v7ba1 | 74 | Transcriptional regulator Cgl2612 {Corynebacterium | 84.58 | |
| d2g7sa1 | 74 | Putative transcriptional regulator Atu0279 {Agroba | 84.55 | |
| d2id6a1 | 75 | Transcriptional regulator TM1030 {Thermotoga marit | 84.33 | |
| d2oi8a1 | 79 | Putative regulatory protein Sco4313 {Streptomyces | 84.28 | |
| d1ixca1 | 89 | LysR-type regulatory protein CbnR {Ralstonia eutro | 84.28 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 84.26 | |
| d1x57a1 | 78 | Endothelial differentiation-related factor 1, EDF1 | 84.0 | |
| d1j9ia_ | 68 | Terminase gpNU1 subunit domain {Bacteriophage lamb | 83.93 | |
| d2fd5a1 | 76 | Probable transcriptional regulator PA3133 {Pseudom | 83.71 | |
| d2vkva1 | 62 | Tetracyclin repressor (Tet-repressor, TetR) {Esche | 83.7 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 83.66 | |
| d2d6ya1 | 68 | Putative regulator SCO4008 {Streptomyces coelicolo | 83.49 | |
| d2fq4a1 | 69 | Transcriptional regulator BC3163 {Bacillus cereus | 83.08 | |
| d1rr7a_ | 94 | Middle operon regulator, Mor {Bacteriophage Mu [Ta | 82.99 | |
| d1y9qa1 | 79 | Probable transcriptional regulator VC1968, N-termi | 82.96 | |
| d3bwga1 | 78 | Transcriptional regulator YydK {Bacillus subtilis | 82.88 | |
| d2fx0a1 | 73 | Hemolysin II regulatory protein, HlyIIR {Bacillus | 82.86 | |
| d2o3fa1 | 83 | Putative transcriptional regulator YbbH {Bacillus | 82.63 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 82.61 | |
| d2fbqa1 | 79 | Transcriptional regulator PsrA {Pseudomonas aerugi | 82.59 | |
| d1r71a_ | 114 | Transcriptional repressor protein KorB DNA-binding | 82.55 | |
| d2np5a1 | 69 | Transcriptional regulator RHA1_ro04179 {Rhodococcu | 82.53 | |
| d2hs5a1 | 69 | Putative transcriptional regulator RHA1_ro03477 {R | 82.41 | |
| d1vi0a1 | 72 | Hypothetical transcriptional regulator YsiA {Bacil | 82.39 | |
| d1p4wa_ | 87 | Transcriptional regulator RcsB {Erwinia amylovora | 82.21 | |
| d1y7ya1 | 69 | Restriction-modification controller protein C.AhdI | 82.08 | |
| d1bl0a1 | 54 | MarA {Escherichia coli [TaxId: 562]} | 82.01 | |
| d1ui5a1 | 71 | A-factor receptor homolog CprB {Streptomyces coeli | 81.99 | |
| d1bl0a2 | 62 | MarA {Escherichia coli [TaxId: 562]} | 81.98 | |
| d2g3ba1 | 72 | Putative transcriptional regulator {Rhodococcus sp | 81.86 | |
| d1z0xa1 | 68 | Transcriptional regulator EF0787 {Enterococcus fae | 81.78 | |
| d1rkta1 | 81 | Hypothetical transcriptional regulator YfiR {Bacil | 81.77 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 81.68 | |
| d2etha1 | 140 | Putative transcriptional regulator TM0816 {Thermot | 81.5 | |
| d1sgma1 | 73 | Putative transcriptional regulator YxaF {Bacillus | 81.44 | |
| d1uxda_ | 59 | Fructose repressor (FruR), N-terminal domain {Esch | 81.14 | |
| d1u2wa1 | 108 | Cadmium efflux system accessory protein CadC {Stap | 81.13 | |
| d1hw1a1 | 74 | Fatty acid responsive transcription factor FadR, N | 80.93 | |
| d2id6a1 | 75 | Transcriptional regulator TM1030 {Thermotoga marit | 80.82 | |
| d1ic8a2 | 94 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (H | 80.76 | |
| d1rr7a_ | 94 | Middle operon regulator, Mor {Bacteriophage Mu [Ta | 80.3 | |
| d2id3a1 | 68 | Putative transcriptional regulator SCO5951 {Strept | 80.28 | |
| d1d5ya1 | 54 | Rob transcription factor, N-terminal domain {Esche | 80.1 |
| >d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Cgl2762-like domain: Uncharacterized protein Cgl2762 species: Corynebacterium glutamicum [TaxId: 1718]
Probab=98.84 E-value=5.6e-09 Score=75.02 Aligned_cols=54 Identities=22% Similarity=0.195 Sum_probs=47.1
Q ss_pred CCCCCCHHHHHHHHHHHHc-CCCCHHHHHHHcCCChhhHHHHHHHhCCCCCCCCC
Q psy17316 29 VTKTWTHEDMDAALEALRA-GQMSLTKASVSYGIPSTTLWQRAHRLGIHTPKKEG 82 (229)
Q Consensus 29 ~~~kyt~e~~~~AI~~~~~-g~~S~~~aA~~~gIp~sTL~~~i~~~gi~~~~~~~ 82 (229)
.+++||.|.+.+||+++.+ +|.|+.++|++|||+.+||++|+++|+..+.....
T Consensus 2 ~rk~Ys~EfK~~aV~l~~~~~g~s~~~vA~~lGIs~~tl~~W~k~~~~~~~~~~~ 56 (89)
T d2jn6a1 2 PTKTYSEEFKRDAVALYENSDGASLQQIANDLGINRVTLKNWIIKYGSNHNVQGT 56 (89)
T ss_dssp CCCCCCHHHHHHHHHHHTTGGGSCHHHHHHHHTSCHHHHHHHHHHHCCCSTTCSC
T ss_pred cCCCCCHHHHHHHHHHHHHcCCCcHHHHHHHHCCCHHHHHHHHHHHhhcccccCC
Confidence 4678999999999999986 47899999999999999999999999877654443
|
| >d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
| >d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
| >d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2coba1 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LCoR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coba1 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LCoR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1g2ha_ a.4.1.12 (A:) Transcriptional regulator TyrR, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1ntca_ a.4.1.12 (A:) DNA-binding domain of NTRC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2ha_ a.4.1.12 (A:) Transcriptional regulator TyrR, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1q06a_ a.6.1.3 (A:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r8da_ a.6.1.3 (A:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1q06a_ a.6.1.3 (A:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1r8da_ a.6.1.3 (A:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r8ea1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8ea1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ezla_ a.4.1.2 (A:) Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase {Bacteriophage mu [TaxId: 10677]} | Back information, alignment and structure |
|---|
| >d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} | Back information, alignment and structure |
|---|
| >d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ao9a1 a.4.1.17 (A:13-132) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2ezla_ a.4.1.2 (A:) Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase {Bacteriophage mu [TaxId: 10677]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ntca_ a.4.1.12 (A:) DNA-binding domain of NTRC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2g7la1 a.4.1.9 (A:16-83) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} | Back information, alignment and structure |
|---|
| >d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2g7ga1 a.4.1.9 (A:9-73) Putative transcriptional regulator Rha04620 {Rhodococcus sp. rha1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2np5a1 a.4.1.9 (A:9-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} | Back information, alignment and structure |
|---|
| >d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i10a1 a.4.1.9 (A:10-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2fbqa1 a.4.1.9 (A:2-80) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1t56a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2gfna1 a.4.1.9 (A:4-80) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. rha1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jt6a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iu5a1 a.4.1.9 (A:1-71) Transcriptional activator DhaS {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zk8a1 a.4.1.9 (A:6-77) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fq4a1 a.4.1.9 (A:9-77) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nera_ a.35.1.2 (A:) Ner {Bacteriophage mu [TaxId: 10677]} | Back information, alignment and structure |
|---|
| >d1v7ba1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2vkva1 a.4.1.9 (A:6-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pb6a1 a.4.1.9 (A:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hkua1 a.4.1.9 (A:18-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ui5a1 a.4.1.9 (A:5-75) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} | Back information, alignment and structure |
|---|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3c07a1 a.4.1.9 (A:15-89) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2o7ta1 a.4.1.9 (A:1-78) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d2i10a1 a.4.1.9 (A:10-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2d6ya1 a.4.1.9 (A:7-74) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1sgma1 a.4.1.9 (A:5-77) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} | Back information, alignment and structure |
|---|
| >d2fx0a1 a.4.1.9 (A:4-76) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2esna1 a.4.5.37 (A:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1t56a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2id3a1 a.4.1.9 (A:13-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1bl0a2 a.4.1.8 (A:63-124) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pb6a1 a.4.1.9 (A:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jt6a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} | Back information, alignment and structure |
|---|
| >d3c07a1 a.4.1.9 (A:15-89) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2g3ba1 a.4.1.9 (A:2-73) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2ao9a1 a.4.1.17 (A:13-132) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2g7ga1 a.4.1.9 (A:9-73) Putative transcriptional regulator Rha04620 {Rhodococcus sp. rha1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2o7ta1 a.4.1.9 (A:1-78) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} | Back information, alignment and structure |
|---|
| >d2hkua1 a.4.1.9 (A:18-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1vi0a1 a.4.1.9 (A:6-77) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} | Back information, alignment and structure |
|---|
| >d2gfna1 a.4.1.9 (A:4-80) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. rha1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1v7ba1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2id6a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2oi8a1 a.4.1.9 (A:8-86) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ixca1 a.4.5.37 (A:1-89) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j9ia_ a.6.1.5 (A:) Terminase gpNU1 subunit domain {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d2fd5a1 a.4.1.9 (A:1-76) Probable transcriptional regulator PA3133 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2vkva1 a.4.1.9 (A:6-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d6ya1 a.4.1.9 (A:7-74) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2fq4a1 a.4.1.9 (A:9-77) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1rr7a_ a.4.1.14 (A:) Middle operon regulator, Mor {Bacteriophage Mu [TaxId: 10677]} | Back information, alignment and structure |
|---|
| >d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fx0a1 a.4.1.9 (A:4-76) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fbqa1 a.4.1.9 (A:2-80) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2np5a1 a.4.1.9 (A:9-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1vi0a1 a.4.1.9 (A:6-77) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} | Back information, alignment and structure |
|---|
| >d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} | Back information, alignment and structure |
|---|
| >d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ui5a1 a.4.1.9 (A:5-75) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1bl0a2 a.4.1.8 (A:63-124) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g3ba1 a.4.1.9 (A:2-73) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1rkta1 a.4.1.9 (A:2-82) Hypothetical transcriptional regulator YfiR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sgma1 a.4.1.9 (A:5-77) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2id6a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ic8a2 a.35.1.1 (A:87-180) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rr7a_ a.4.1.14 (A:) Middle operon regulator, Mor {Bacteriophage Mu [TaxId: 10677]} | Back information, alignment and structure |
|---|
| >d2id3a1 a.4.1.9 (A:13-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|