Psyllid ID: psy17316


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MMITPELLGLLPSSNYSDGETDKAGSLTVTKTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGIHTPKKEGPTKSWNEEILNVALDALRAGSISANKASKAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNASPTAWKPEDLEIALEGIRSGQTTVQRASAEYGIPSGTLYGRCKLSRSTPRPPPGNLKTSR
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHcHHcccccccccccccHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHcccccccccccccccc
ccccHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccHcccHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHccccEccccccccccccHHHHHHHHHHHHcccccHHHHHHHHccccccEccccEccccccccccccccccc
mmitpellgllpssnysdgetdkagsltvtktwtHEDMDAALEALRAGQMSLTKasvsygipsttLWQRAHrlgihtpkkegptkswNEEILNVALDALRagsisankaskaygptkswNEEILNVALDALRagsisankaskaygipsstLYKIARKEGirlaqpfnasptawkpedLEIALEGIRSGQTTVQRAsaeygipsgtlygrcklsrstprpppgnlktsr
mmitpellgllpssnysdgetdKAGSLTVTKTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGihtpkkegptksWNEEILNVALDALRAGSISANKaskaygptkswNEEILNVALDALRAGSisankaskaygipsSTLYKIARKEGIRLAqpfnasptawKPEDLEIALEGIrsgqttvqrasaeygipsgtlygrcklsrstprpppgnlktsr
MMITPELLGLLPSSNYSDGETDKAGSLTVTKTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGIHTPKKEGPTKSWNEEILNVALDALRAGSISANKASKAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNASPTAWKPEDLEIALEGIRSGQTTVQRASAEYGIPSGTLYGRCKLSRSTPRPPPGNLKTSR
****************************VTKTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGIHT********SWNEEILNVALDALRAGSIS******AYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNASPTAWKPEDLEIALEGIRS*********AEYGIPSGTLYGRC******************
***T********************************DMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHR************************************************************************YGIPSSTLY****************************************QRASAEYGIPSGTLYG********************
MMITPELLGLLPSSNYSDGETDKAGSLTVTKTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGIHTPKKEGPTKSWNEEILNVALDALRAGSISANKASKAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNASPTAWKPEDLEIALEGIRSGQTTVQRASAEYGIPSGTLYGRCKLSR**************
******************************KTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGIHTPKKEGPTKSWNEEILNVALDALRAGSI**NKA*****PTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNASPTAWKPEDLEIALEGIRSGQTTVQRASAEYGIPSGTLYGRCKLSRST************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMITPELLGLLPSSNYSDGETDKAGSLTVTKTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGIHTPKKEGPTKSWNEEILNVALDALRAGSISANKASKAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNASPTAWKPEDLEIALEGIRSGQTTVQRASAEYGIPSGTLYGRCKLSRSTPRPPPGNLKTSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
345491641 657 PREDICTED: hypothetical protein LOC10012 0.820 0.286 0.625 2e-68
383864280 675 PREDICTED: uncharacterized protein LOC10 0.820 0.278 0.612 2e-67
350400311 648 PREDICTED: hypothetical protein LOC10074 0.820 0.290 0.612 1e-66
340717913 645 PREDICTED: hypothetical protein LOC10064 0.820 0.291 0.612 1e-66
58585152 652 pipsqueak [Apis mellifera] gi|3746878|gb 0.820 0.288 0.612 2e-66
380012351 648 PREDICTED: uncharacterized protein LOC10 0.820 0.290 0.612 2e-66
193683716 701 PREDICTED: hypothetical protein LOC10015 0.820 0.268 0.583 2e-66
322794753 540 hypothetical protein SINV_02021 [Solenop 0.820 0.348 0.595 3e-65
242004638 698 pipsqueak, putative [Pediculus humanus c 0.803 0.263 0.595 3e-65
332026413 517 hypothetical protein G5I_05017 [Acromyrm 0.820 0.363 0.595 3e-65
>gi|345491641|ref|XP_001607008.2| PREDICTED: hypothetical protein LOC100123373 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 147/235 (62%), Positives = 165/235 (70%), Gaps = 47/235 (20%)

Query: 1   MMITPELLGLLPS--SNYSD-GETD------KAGSLTV-TKTWTHEDMDAALEALRAGQM 50
           MMITPELLGL+PS  S +SD GE +      ++GS    +K+WT EDMDAALEALR   M
Sbjct: 373 MMITPELLGLMPSGSSVHSDSGENNSRTHSGQSGSHHHGSKSWTQEDMDAALEALRNHDM 432

Query: 51  SLTKASVSYGIPSTTLWQRAHRLGIHTPKKEGPTKSWNEEILNVALDALRAGSISANKAS 110
           SLTKAS ++GIPSTTLWQRAHRLGI TPKK+GPTKSW++E LN ALDALR G+ISANKAS
Sbjct: 433 SLTKASATFGIPSTTLWQRAHRLGIETPKKDGPTKSWSDESLNNALDALRTGTISANKAS 492

Query: 111 KAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNAS 170
           KA                                +GIPSSTLYKIAR+EGIRLA PFNAS
Sbjct: 493 KA--------------------------------FGIPSSTLYKIARREGIRLAAPFNAS 520

Query: 171 PTAWKPEDLEIALEGIRSGQTTVQRASAEYGIPSGTLYGRCK-----LSRSTPRP 220
           PT W P DL+ ALE IRSGQT+VQRA+ EYGIPSGTLYGRCK     LSRS P P
Sbjct: 521 PTTWSPADLDRALEAIRSGQTSVQRAATEYGIPSGTLYGRCKREGIELSRSNPTP 575




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383864280|ref|XP_003707607.1| PREDICTED: uncharacterized protein LOC100880546 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350400311|ref|XP_003485795.1| PREDICTED: hypothetical protein LOC100749194 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340717913|ref|XP_003397418.1| PREDICTED: hypothetical protein LOC100649846 [Bombus terrestris] Back     alignment and taxonomy information
>gi|58585152|ref|NP_001011602.1| pipsqueak [Apis mellifera] gi|3746878|gb|AAC71015.1| pipsqueak [Apis mellifera] Back     alignment and taxonomy information
>gi|380012351|ref|XP_003690248.1| PREDICTED: uncharacterized protein LOC100864657 [Apis florea] Back     alignment and taxonomy information
>gi|193683716|ref|XP_001947249.1| PREDICTED: hypothetical protein LOC100159948 isoform 1 [Acyrthosiphon pisum] gi|328700169|ref|XP_003241167.1| PREDICTED: hypothetical protein LOC100159948 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|322794753|gb|EFZ17700.1| hypothetical protein SINV_02021 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|242004638|ref|XP_002423187.1| pipsqueak, putative [Pediculus humanus corporis] gi|212506152|gb|EEB10449.1| pipsqueak, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332026413|gb|EGI66542.1| hypothetical protein G5I_05017 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
FB|FBgn0263102 1085 psq "pipsqueak" [Drosophila me 0.480 0.101 0.730 1.7e-39
WB|WBGene00011315433 mbr-1 [Caenorhabditis elegans 0.187 0.099 0.395 6.8e-05
UNIPROTKB|G3N278601 LCORL "Uncharacterized protein 0.262 0.099 0.327 0.0001
UNIPROTKB|Q95YM8 1598 Mblk-1 "Mushroom body large-ty 0.196 0.028 0.333 0.00026
UNIPROTKB|F1P637558 LCORL "Uncharacterized protein 0.244 0.100 0.333 0.00042
UNIPROTKB|D3K5M5603 LCORL "Ligand dependent nuclea 0.244 0.092 0.333 0.0005
UNIPROTKB|F1NH98551 LCORL "Ligand-dependent nuclea 0.244 0.101 0.333 0.00051
UNIPROTKB|Q5ZJK5600 LCORL "Ligand-dependent nuclea 0.244 0.093 0.333 0.00063
FB|FBgn0263102 psq "pipsqueak" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 419 (152.6 bits), Expect = 1.7e-39, Sum P(2) = 1.7e-39
 Identities = 84/115 (73%), Positives = 95/115 (82%)

Query:   111 KAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNAS 170
             K  G TKSWNE+ L  AL+ALR+G ISANKASKA+GIPSSTLYKIAR+EGIRLA PFNA+
Sbjct:   773 KKEGGTKSWNEDALQNALEALRSGQISANKASKAFGIPSSTLYKIARREGIRLAAPFNAA 832

Query:   171 PTAWKPEDLEIALEGIRSGQTTVQRASAEYGIPSGTLYGRCK-----LSRSTPRP 220
             PT W PEDLE ALE IR+G T+VQ+ASAE+GIP+GTLYGRCK     LSRS P P
Sbjct:   833 PTTWTPEDLERALEAIRAGNTSVQKASAEFGIPTGTLYGRCKREGIELSRSNPTP 887


GO:0007315 "pole plasm assembly" evidence=NAS
GO:0005634 "nucleus" evidence=IDA;TAS
GO:0003677 "DNA binding" evidence=NAS;TAS
GO:0006342 "chromatin silencing" evidence=IMP
GO:0031519 "PcG protein complex" evidence=IDA
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0016458 "gene silencing" evidence=TAS
GO:0008595 "anterior/posterior axis specification, embryo" evidence=IMP
GO:0042048 "olfactory behavior" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0031935 "regulation of chromatin silencing" evidence=IMP
GO:0009880 "embryonic pattern specification" evidence=IMP
WB|WBGene00011315 mbr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|G3N278 LCORL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q95YM8 Mblk-1 "Mushroom body large-type Kenyon cell-specific protein 1" [Apis mellifera (taxid:7460)] Back     alignment and assigned GO terms
UNIPROTKB|F1P637 LCORL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D3K5M5 LCORL "Ligand dependent nuclear receptor corepressor-like protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH98 LCORL "Ligand-dependent nuclear receptor corepressor-like protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJK5 LCORL "Ligand-dependent nuclear receptor corepressor-like protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
pfam0522543 pfam05225, HTH_psq, helix-turn-helix, Psq domain 3e-10
pfam0522543 pfam05225, HTH_psq, helix-turn-helix, Psq domain 2e-07
pfam0522543 pfam05225, HTH_psq, helix-turn-helix, Psq domain 2e-07
>gnl|CDD|203213 pfam05225, HTH_psq, helix-turn-helix, Psq domain Back     alignment and domain information
 Score = 53.3 bits (129), Expect = 3e-10
 Identities = 22/44 (50%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 36 EDMDAALEALRAGQMSLTKASVSYGIPSTTLWQRAHRLGIHTPK 79
          ED+  ALEA+R G+MSL KA+  YGIP +TLW R  R      +
Sbjct: 1  EDLAEALEAVRNGKMSLRKAARKYGIPRSTLW-RRLRGKYSLKR 43


This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster. In pipsqueak this domain binds to GAGA sequence. Length = 43

>gnl|CDD|203213 pfam05225, HTH_psq, helix-turn-helix, Psq domain Back     alignment and domain information
>gnl|CDD|203213 pfam05225, HTH_psq, helix-turn-helix, Psq domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 229
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 99.2
PF0522545 HTH_psq: helix-turn-helix, Psq domain; InterPro: I 99.05
COG3415138 Transposase and inactivated derivatives [DNA repli 99.03
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 98.93
COG3415138 Transposase and inactivated derivatives [DNA repli 98.89
PF0522545 HTH_psq: helix-turn-helix, Psq domain; InterPro: I 98.82
cd00131128 PAX Paired Box domain 98.81
smart00351125 PAX Paired Box domain. 98.7
COG2963116 Transposase and inactivated derivatives [DNA repli 98.66
PF13551112 HTH_29: Winged helix-turn helix 98.63
PF13551112 HTH_29: Winged helix-turn helix 98.63
cd00131128 PAX Paired Box domain 98.58
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 98.57
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 98.54
smart00351125 PAX Paired Box domain. 98.49
PRK09413121 IS2 repressor TnpA; Reviewed 98.47
COG2963116 Transposase and inactivated derivatives [DNA repli 98.46
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 98.42
PRK09413121 IS2 repressor TnpA; Reviewed 98.4
PF1351852 HTH_28: Helix-turn-helix domain 98.4
PF1351852 HTH_28: Helix-turn-helix domain 98.38
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 98.34
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 98.25
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 98.23
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 98.09
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 97.98
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 97.97
cd0110468 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain 97.8
PF0605658 Terminase_5: Putative ATPase subunit of terminase 97.79
PF0960758 BrkDBD: Brinker DNA-binding domain; InterPro: IPR0 97.74
cd0110468 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain 97.73
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 97.68
PF0605658 Terminase_5: Putative ATPase subunit of terminase 97.65
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 97.63
cd0476467 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom 97.63
PF1301185 LZ_Tnp_IS481: leucine-zipper of insertion element 97.62
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 97.56
PF1341169 MerR_1: MerR HTH family regulatory protein; PDB: 2 97.43
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 97.41
PF1301185 LZ_Tnp_IS481: leucine-zipper of insertion element 97.34
cd0476368 HTH_MlrA-like Helix-Turn-Helix DNA binding domain 97.32
PRK13413200 mpi multiple promoter invertase; Provisional 97.27
PF1341169 MerR_1: MerR HTH family regulatory protein; PDB: 2 97.24
cd0476368 HTH_MlrA-like Helix-Turn-Helix DNA binding domain 97.18
PF1356577 HTH_32: Homeodomain-like domain 97.17
cd0476467 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom 97.14
cd0476249 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain 97.11
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 97.1
PHA02535 581 P terminase ATPase subunit; Provisional 97.08
KOG4565|consensus206 97.05
PF0960758 BrkDBD: Brinker DNA-binding domain; InterPro: IPR0 97.04
PF0295442 HTH_8: Bacterial regulatory protein, Fis family; I 96.97
PRK11511127 DNA-binding transcriptional activator MarA; Provis 96.9
PRK10219107 DNA-binding transcriptional regulator SoxS; Provis 96.89
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 96.86
smart0042270 HTH_MERR helix_turn_helix, mercury resistance. 96.81
PF1211682 SpoIIID: Stage III sporulation protein D; InterPro 96.81
cd0478896 HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain 96.78
PHA0067578 hypothetical protein 96.78
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 96.77
PHA02535 581 P terminase ATPase subunit; Provisional 96.75
KOG4565|consensus206 96.74
cd0110588 HTH_GlnR-like Helix-Turn-Helix DNA binding domain 96.67
cd0478896 HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain 96.66
cd01106103 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain 96.64
smart0042270 HTH_MERR helix_turn_helix, mercury resistance. 96.62
cd0110588 HTH_GlnR-like Helix-Turn-Helix DNA binding domain 96.61
PF00292125 PAX: 'Paired box' domain; InterPro: IPR001523 The 96.61
cd0476599 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding dom 96.61
cd0476249 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain 96.55
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 96.55
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 96.55
cd0476599 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding dom 96.53
PRK13182175 racA polar chromosome segregation protein; Reviewe 96.52
PF1066860 Phage_terminase: Phage terminase small subunit; In 96.5
TIGR0253188 yecD_yerC TrpR-related protein YerC/YecD. This mod 96.49
TIGR0176449 excise DNA binding domain, excisionase family. An 96.48
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 96.46
COG2826 318 Tra8 Transposase and inactivated derivatives, IS30 96.46
cd0476149 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of 96.43
PF0295442 HTH_8: Bacterial regulatory protein, Fis family; I 96.42
cd0476896 HTH_BmrR-like Helix-Turn-Helix DNA binding domain 96.38
PRK11511127 DNA-binding transcriptional activator MarA; Provis 96.3
PF1354252 HTH_Tnp_ISL3: Helix-turn-helix domain of transposa 96.27
PF0204252 RWP-RK: RWP-RK domain; InterPro: IPR003035 This do 96.25
PRK04217110 hypothetical protein; Provisional 96.23
cd0478297 HTH_BltR Helix-Turn-Helix DNA binding domain of th 96.22
PF1356577 HTH_32: Homeodomain-like domain 96.22
cd0476896 HTH_BmrR-like Helix-Turn-Helix DNA binding domain 96.21
cd04775102 HTH_Cfa-like Helix-Turn-Helix DNA binding domain o 96.16
COG134299 Predicted DNA-binding proteins [General function p 96.16
cd01106103 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain 96.15
PRK13413200 mpi multiple promoter invertase; Provisional 96.14
cd01109113 HTH_YyaN Helix-Turn-Helix DNA binding domain of th 96.13
cd01282112 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding dom 96.11
TIGR0253188 yecD_yerC TrpR-related protein YerC/YecD. This mod 96.1
PF1272851 HTH_17: Helix-turn-helix domain 96.1
PF1066860 Phage_terminase: Phage terminase small subunit; In 96.1
cd00592100 HTH_MerR-like Helix-Turn-Helix DNA binding domain 96.07
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 96.06
cd01110139 HTH_SoxR Helix-Turn-Helix DNA binding domain of th 96.06
PF1354252 HTH_Tnp_ISL3: Helix-turn-helix domain of transposa 96.05
PF1330964 HTH_22: HTH domain 96.04
cd01109113 HTH_YyaN Helix-Turn-Helix DNA binding domain of th 96.01
PRK11608326 pspF phage shock protein operon transcriptional ac 95.99
cd01282112 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding dom 95.99
PRK15044295 transcriptional regulator SirC; Provisional 95.98
PF07900220 DUF1670: Protein of unknown function (DUF1670); In 95.98
PRK15186291 AraC family transcriptional regulator; Provisional 95.97
cd00592100 HTH_MerR-like Helix-Turn-Helix DNA binding domain 95.96
cd01110139 HTH_SoxR Helix-Turn-Helix DNA binding domain of th 95.92
cd04775102 HTH_Cfa-like Helix-Turn-Helix DNA binding domain o 95.91
cd01107108 HTH_BmrR Helix-Turn-Helix DNA binding domain of th 95.91
cd04790172 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding doma 95.89
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 95.89
PRK0190577 DNA-binding protein Fis; Provisional 95.89
PRK04217110 hypothetical protein; Provisional 95.87
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 95.86
cd01107108 HTH_BmrR Helix-Turn-Helix DNA binding domain of th 95.85
TIGR0176449 excise DNA binding domain, excisionase family. An 95.85
PRK10219107 DNA-binding transcriptional regulator SoxS; Provis 95.84
cd04785126 HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding do 95.83
cd0478095 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding dom 95.82
PRK13503278 transcriptional activator RhaS; Provisional 95.75
cd0477496 HTH_YfmP Helix-Turn-Helix DNA binding domain of th 95.75
cd0478297 HTH_BltR Helix-Turn-Helix DNA binding domain of th 95.74
cd0478095 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding dom 95.73
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 95.72
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 95.72
cd04789102 HTH_Cfa Helix-Turn-Helix DNA binding domain of the 95.71
cd0476149 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of 95.7
cd04773108 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding 95.69
cd04789102 HTH_Cfa Helix-Turn-Helix DNA binding domain of the 95.68
cd04781120 HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding dom 95.68
cd04781120 HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding dom 95.66
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 95.61
PRK09978274 DNA-binding transcriptional regulator GadX; Provis 95.61
PRK0138199 Trp operon repressor; Provisional 95.57
PF02001106 DUF134: Protein of unknown function DUF134; InterP 95.56
cd01108127 HTH_CueR Helix-Turn-Helix DNA binding domain of Cu 95.55
PRK15185309 transcriptional regulator HilD; Provisional 95.53
cd0127998 HTH_HspR-like Helix-Turn-Helix DNA binding domain 95.52
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 95.52
cd01111107 HTH_MerD Helix-Turn-Helix DNA binding domain of th 95.5
cd04770123 HTH_HMRTR Helix-Turn-Helix DNA binding domain of H 95.46
cd04773108 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding 95.45
cd0477496 HTH_YfmP Helix-Turn-Helix DNA binding domain of th 95.44
PRK15115444 response regulator GlrR; Provisional 95.43
cd04767120 HTH_HspR-like_MBC Helix-Turn-Helix DNA binding dom 95.41
TIGR02043131 ZntR Zn(II)-responsive transcriptional regulator. 95.39
cd01108127 HTH_CueR Helix-Turn-Helix DNA binding domain of Cu 95.36
PF1211682 SpoIIID: Stage III sporulation protein D; InterPro 95.35
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 95.34
cd04783126 HTH_MerR1 Helix-Turn-Helix DNA binding domain of t 95.32
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 95.31
PF1272851 HTH_17: Helix-turn-helix domain 95.31
PRK13501290 transcriptional activator RhaR; Provisional 95.3
cd04769116 HTH_MerR2 Helix-Turn-Helix DNA binding domain of M 95.28
PRK13182175 racA polar chromosome segregation protein; Reviewe 95.28
PRK15043 243 transcriptional regulator MirA; Provisional 95.26
COG3829560 RocR Transcriptional regulator containing PAS, AAA 95.23
TIGR02043131 ZntR Zn(II)-responsive transcriptional regulator. 95.23
cd0127998 HTH_HspR-like Helix-Turn-Helix DNA binding domain 95.21
PF1361353 HTH_Tnp_4: Helix-turn-helix of DDE superfamily end 95.21
cd04785126 HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding do 95.2
TIGR02044127 CueR Cu(I)-responsive transcriptional regulator. T 95.2
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 95.2
cd04770123 HTH_HMRTR Helix-Turn-Helix DNA binding domain of H 95.2
cd04790172 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding doma 95.18
TIGR02044127 CueR Cu(I)-responsive transcriptional regulator. T 95.18
PRK0043095 fis global DNA-binding transcriptional dual regula 95.17
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 95.16
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 95.14
cd04783126 HTH_MerR1 Helix-Turn-Helix DNA binding domain of t 95.13
PF07750162 GcrA: GcrA cell cycle regulator; InterPro: IPR0116 95.11
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 95.1
cd0476691 HTH_HspR Helix-Turn-Helix DNA binding domain of th 95.08
PHA0067578 hypothetical protein 95.07
cd04786131 HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding dom 95.06
cd04769116 HTH_MerR2 Helix-Turn-Helix DNA binding domain of M 95.05
PRK09514140 zntR zinc-responsive transcriptional regulator; Pr 95.05
cd01111107 HTH_MerD Helix-Turn-Helix DNA binding domain of th 95.03
PRK09393322 ftrA transcriptional activator FtrA; Provisional 95.03
TIGR02297287 HpaA 4-hydroxyphenylacetate catabolism regulatory 95.01
PRK09514140 zntR zinc-responsive transcriptional regulator; Pr 95.0
PRK13502282 transcriptional activator RhaR; Provisional 94.99
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 94.99
PRK00118104 putative DNA-binding protein; Validated 94.98
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 94.92
PF00292125 PAX: 'Paired box' domain; InterPro: IPR001523 The 94.91
PHA0054282 putative Cro-like protein 94.91
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 94.89
cd04767120 HTH_HspR-like_MBC Helix-Turn-Helix DNA binding dom 94.88
PRK10572290 DNA-binding transcriptional regulator AraC; Provis 94.87
cd04784127 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain 94.86
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 94.85
PRK05022509 anaerobic nitric oxide reductase transcription reg 94.84
TIGR02047127 CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional 94.84
PF1283381 HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_ 94.83
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 94.83
COG134299 Predicted DNA-binding proteins [General function p 94.83
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 94.82
TIGR02047127 CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional 94.77
PHA0259183 hypothetical protein; Provisional 94.77
PRK15043243 transcriptional regulator MirA; Provisional 94.75
COG0789124 SoxR Predicted transcriptional regulators [Transcr 94.72
PRK15121 289 right oriC-binding transcriptional activator; Prov 94.69
cd0476691 HTH_HspR Helix-Turn-Helix DNA binding domain of th 94.69
TIGR02051124 MerR Hg(II)-responsive transcriptional regulator. 94.68
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 94.66
PF02001106 DUF134: Protein of unknown function DUF134; InterP 94.64
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 94.64
cd04786131 HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding dom 94.63
TIGR0284480 spore_III_D sporulation transcriptional regulator 94.59
TIGR01950142 SoxR redox-sensitive transcriptional activator Sox 94.59
COG2826 318 Tra8 Transposase and inactivated derivatives, IS30 94.56
cd04776118 HTH_GnyR Helix-Turn-Helix DNA binding domain of th 94.56
PF13022142 HTH_Tnp_1_2: Helix-turn-helix of insertion element 94.51
COG2973103 TrpR Trp operon repressor [Transcription] 94.51
cd04787133 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain 94.51
PF0137187 Trp_repressor: Trp repressor protein; InterPro: IP 94.47
PRK13500312 transcriptional activator RhaR; Provisional 94.47
PF1361353 HTH_Tnp_4: Helix-turn-helix of DDE superfamily end 94.46
PRK09940253 transcriptional regulator YdeO; Provisional 94.46
PRK00118104 putative DNA-binding protein; Validated 94.42
PF07750 162 GcrA: GcrA cell cycle regulator; InterPro: IPR0116 94.41
cd04784127 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain 94.41
cd04776118 HTH_GnyR Helix-Turn-Helix DNA binding domain of th 94.37
TIGR01817534 nifA Nif-specific regulatory protein. This model r 94.34
cd04779134 HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding dom 94.32
PRK15002154 redox-sensitivie transcriptional activator SoxR; P 94.3
COG5484 279 Uncharacterized conserved protein [Function unknow 94.26
TIGR02054120 MerD mercuric resistence transcriptional repressor 94.25
cd04779134 HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding dom 94.23
PF0368376 UPF0175: Uncharacterised protein family (UPF0175); 94.23
PRK10227135 DNA-binding transcriptional regulator CueR; Provis 94.22
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 94.18
PF09824160 ArsR: ArsR transcriptional regulator; InterPro: IP 94.17
TIGR01950142 SoxR redox-sensitive transcriptional activator Sox 94.14
TIGR02054120 MerD mercuric resistence transcriptional repressor 94.14
PF0662790 DUF1153: Protein of unknown function (DUF1153); In 94.14
PHA02943 165 hypothetical protein; Provisional 94.13
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 94.13
PHA0054282 putative Cro-like protein 94.11
cd04778219 HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding dom 94.09
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 94.07
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 94.05
PF04297101 UPF0122: Putative helix-turn-helix protein, YlxM / 94.02
cd04787133 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain 93.99
PRK15424538 propionate catabolism operon regulatory protein Pr 93.95
PRK15429686 formate hydrogenlyase transcriptional activator Fh 93.88
PF0368376 UPF0175: Uncharacterised protein family (UPF0175); 93.87
PRK10371302 DNA-binding transcriptional regulator MelR; Provis 93.87
TIGR03734 554 PRTRC_parB PRTRC system ParB family protein. A nov 93.83
PRK0138199 Trp operon repressor; Provisional 93.75
PF08822165 DUF1804: Protein of unknown function (DUF1804); In 93.74
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 93.73
COG0789124 SoxR Predicted transcriptional regulators [Transcr 93.71
PRK10227135 DNA-binding transcriptional regulator CueR; Provis 93.68
PF0138155 HTH_3: Helix-turn-helix; InterPro: IPR001387 This 93.67
PRK15002154 redox-sensitivie transcriptional activator SoxR; P 93.53
PF0019658 GerE: Bacterial regulatory proteins, luxR family; 93.49
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 93.47
PF1330964 HTH_22: HTH domain 93.45
PF04297101 UPF0122: Putative helix-turn-helix protein, YlxM / 93.45
cd04777107 HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding dom 93.43
PF0333391 PapB: Adhesin biosynthesis transcription regulator 93.39
TIGR0284480 spore_III_D sporulation transcriptional regulator 93.39
TIGR02051124 MerR Hg(II)-responsive transcriptional regulator. 93.38
PF1355659 HTH_30: PucR C-terminal helix-turn-helix domain; P 93.3
PF1449391 HTH_40: Helix-turn-helix domain 93.29
PF0137187 Trp_repressor: Trp repressor protein; InterPro: IP 93.26
PRK15435 353 bifunctional DNA-binding transcriptional dual regu 93.23
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 93.2
COG2207127 AraC AraC-type DNA-binding domain-containing prote 93.19
PRK15044295 transcriptional regulator SirC; Provisional 93.19
PF0138155 HTH_3: Helix-turn-helix; InterPro: IPR001387 This 93.16
PF06163127 DUF977: Bacterial protein of unknown function (DUF 93.04
PRK15186291 AraC family transcriptional regulator; Provisional 93.04
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 92.98
PHA0197667 helix-turn-helix protein 92.97
COG2204464 AtoC Response regulator containing CheY-like recei 92.97
PRK13501290 transcriptional activator RhaR; Provisional 92.93
PRK11169164 leucine-responsive transcriptional regulator; Prov 92.9
COG331170 AlpA Predicted transcriptional regulator [Transcri 92.89
PRK13752144 putative transcriptional regulator MerR; Provision 92.84
COG3677129 Transposase and inactivated derivatives [DNA repli 92.79
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 92.78
PRK13749121 transcriptional regulator MerD; Provisional 92.75
COG5484279 Uncharacterized conserved protein [Function unknow 92.74
cd04777107 HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding dom 92.58
PF1449391 HTH_40: Helix-turn-helix domain 92.53
PF1355659 HTH_30: PucR C-terminal helix-turn-helix domain; P 92.52
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 92.51
PF08822165 DUF1804: Protein of unknown function (DUF1804); In 92.49
PRK13752144 putative transcriptional regulator MerR; Provision 92.48
cd0657190 Bac_DnaA_C C-terminal domain of bacterial DnaA pro 92.47
PF1454960 P22_Cro: DNA-binding transcriptional regulator Cro 92.46
PF1344363 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3 92.43
PRK15185309 transcriptional regulator HilD; Provisional 92.42
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 92.39
PRK0972688 antitoxin HipB; Provisional 92.39
cd0477299 HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding d 92.34
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 92.29
TIGR02974329 phageshock_pspF psp operon transcriptional activat 92.29
PF0141877 HTH_6: Helix-turn-helix domain, rpiR family; Inter 92.29
PRK06759154 RNA polymerase factor sigma-70; Validated 92.24
PRK09863 584 putative frv operon regulatory protein; Provisiona 92.16
PRK15435 353 bifunctional DNA-binding transcriptional dual regu 92.11
PF03374111 ANT: Phage antirepressor protein KilAC domain; Int 92.11
PF1344363 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3 92.1
PRK13502282 transcriptional activator RhaR; Provisional 92.09
PF04936186 DUF658: Protein of unknown function (DUF658); Inte 92.06
PRK09685302 DNA-binding transcriptional activator FeaR; Provis 92.01
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 92.01
TIGR02989159 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop 91.99
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 91.92
PF1284464 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_ 91.87
PRK12537182 RNA polymerase sigma factor; Provisional 91.84
PF0593051 Phage_AlpA: Prophage CP4-57 regulatory protein (Al 91.82
PF07900220 DUF1670: Protein of unknown function (DUF1670); In 91.8
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 91.79
PRK11608326 pspF phage shock protein operon transcriptional ac 91.79
PRK09940253 transcriptional regulator YdeO; Provisional 91.77
PRK10365441 transcriptional regulatory protein ZraR; Provision 91.77
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 91.75
PRK09393322 ftrA transcriptional activator FtrA; Provisional 91.74
PRK10371302 DNA-binding transcriptional regulator MelR; Provis 91.74
TIGR02297287 HpaA 4-hydroxyphenylacetate catabolism regulatory 91.74
PRK09652182 RNA polymerase sigma factor RpoE; Provisional 91.7
TIGR02937158 sigma70-ECF RNA polymerase sigma factor, sigma-70 91.56
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 91.52
PRK13503278 transcriptional activator RhaS; Provisional 91.52
PF1283381 HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_ 91.51
PRK10572290 DNA-binding transcriptional regulator AraC; Provis 91.51
PRK0190577 DNA-binding protein Fis; Provisional 91.37
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 91.32
COG2207127 AraC AraC-type DNA-binding domain-containing prote 91.32
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 91.28
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 91.26
COG2944104 Predicted transcriptional regulator [Transcription 91.26
PRK13749121 transcriptional regulator MerD; Provisional 91.19
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 91.18
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 91.16
PF0012660 HTH_1: Bacterial regulatory helix-turn-helix prote 91.13
PRK1007296 putative transcriptional regulator; Provisional 91.12
TIGR02329526 propionate_PrpR propionate catabolism operon regul 91.1
PRK09978274 DNA-binding transcriptional regulator GadX; Provis 91.08
cd0477299 HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding d 90.95
PF0534465 DUF746: Domain of Unknown Function (DUF746); Inter 90.77
cd04778 219 HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding dom 90.74
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 90.67
PRK15340216 transcriptional regulator InvF; Provisional 90.66
COG290198 Fis Factor for inversion stimulation Fis, transcri 90.65
PF12298172 Bot1p: Eukaryotic mitochondrial regulator protein 90.63
PRK06759154 RNA polymerase factor sigma-70; Validated 90.61
PRK15418 318 transcriptional regulator LsrR; Provisional 90.61
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 90.55
PRK12525168 RNA polymerase sigma factor; Provisional 90.53
PRK10130350 transcriptional regulator EutR; Provisional 90.5
COG2973103 TrpR Trp operon repressor [Transcription] 90.49
COG2739105 Uncharacterized protein conserved in bacteria [Fun 90.44
TIGR02999183 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f 90.43
PF13022142 HTH_Tnp_1_2: Helix-turn-helix of insertion element 90.4
PRK06288268 RNA polymerase sigma factor WhiG; Reviewed 90.37
PRK12547164 RNA polymerase sigma factor; Provisional 90.37
PRK1007296 putative transcriptional regulator; Provisional 90.36
TIGR02989159 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop 90.25
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 90.22
PRK11924179 RNA polymerase sigma factor; Provisional 90.21
PHA00738108 putative HTH transcription regulator 90.1
PRK09639166 RNA polymerase sigma factor SigX; Provisional 90.1
PRK06986236 fliA flagellar biosynthesis sigma factor; Validate 90.1
TIGR02952170 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 90.07
COG2739105 Uncharacterized protein conserved in bacteria [Fun 90.07
PRK09646194 RNA polymerase sigma factor SigK; Reviewed 90.05
TIGR02366176 DHAK_reg probable dihydroxyacetone kinase regulato 90.04
PRK15115444 response regulator GlrR; Provisional 89.97
PRK06474 178 hypothetical protein; Provisional 89.87
TIGR02985161 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba 89.87
PF0037638 MerR: MerR family regulatory protein; InterPro: IP 89.86
TIGR0307058 couple_hipB transcriptional regulator, y4mF family 89.8
PF1275946 HTH_Tnp_IS1: InsA C-terminal domain; InterPro: IPR 89.8
PF0593051 Phage_AlpA: Prophage CP4-57 regulatory protein (Al 89.79
PF0662790 DUF1153: Protein of unknown function (DUF1153); In 89.79
PRK12520191 RNA polymerase sigma factor; Provisional 89.77
PRK09047161 RNA polymerase factor sigma-70; Validated 89.76
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 89.75
PHA0259183 hypothetical protein; Provisional 89.75
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 89.73
PRK09644165 RNA polymerase sigma factor SigM; Provisional 89.72
TIGR0260778 antidote_HigA addiction module antidote protein, H 89.69
PRK13919186 putative RNA polymerase sigma E protein; Provision 89.68
PRK12528161 RNA polymerase sigma factor; Provisional 89.68
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 89.62
PRK09415179 RNA polymerase factor sigma C; Reviewed 89.61
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 89.57
PF0019658 GerE: Bacterial regulatory proteins, luxR family; 89.48
TIGR02983162 SigE-fam_strep RNA polymerase sigma-70 factor, sig 89.46
PF07638185 Sigma70_ECF: ECF sigma factor 89.46
PRK12543179 RNA polymerase sigma factor; Provisional 89.41
PRK12540182 RNA polymerase sigma factor; Provisional 89.39
PRK12532195 RNA polymerase sigma factor; Provisional 89.37
TIGR0063799 ModE_repress ModE molybdate transport repressor do 89.36
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 89.36
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 89.36
PRK15121 289 right oriC-binding transcriptional activator; Prov 89.36
PRK12539184 RNA polymerase sigma factor; Provisional 89.27
TIGR03001244 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxoco 89.27
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 89.25
PRK10365441 transcriptional regulatory protein ZraR; Provision 89.24
PRK05602186 RNA polymerase sigma factor; Reviewed 89.23
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 89.22
PRK12527159 RNA polymerase sigma factor; Reviewed 89.21
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 89.21
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 89.21
PRK12514179 RNA polymerase sigma factor; Provisional 89.19
PRK13500312 transcriptional activator RhaR; Provisional 89.16
PRK12511182 RNA polymerase sigma factor; Provisional 89.15
PRK12528161 RNA polymerase sigma factor; Provisional 89.11
PF0204252 RWP-RK: RWP-RK domain; InterPro: IPR003035 This do 89.08
COG1595182 RpoE DNA-directed RNA polymerase specialized sigma 89.08
COG1710139 Uncharacterized protein conserved in archaea [Func 89.06
PRK07037163 extracytoplasmic-function sigma-70 factor; Validat 88.98
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 88.93
PRK12536181 RNA polymerase sigma factor; Provisional 88.9
COG3877122 Uncharacterized protein conserved in bacteria [Fun 88.86
PF1454960 P22_Cro: DNA-binding transcriptional regulator Cro 88.84
PF0044047 TetR_N: Bacterial regulatory proteins, tetR family 88.83
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 88.82
PRK12529178 RNA polymerase sigma factor; Provisional 88.82
PRK15340216 transcriptional regulator InvF; Provisional 88.77
TIGR02329526 propionate_PrpR propionate catabolism operon regul 88.77
PRK12530189 RNA polymerase sigma factor; Provisional 88.74
TIGR02943188 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 88.74
TIGR02937158 sigma70-ECF RNA polymerase sigma factor, sigma-70 88.71
PRK11169164 leucine-responsive transcriptional regulator; Prov 88.69
PRK12519194 RNA polymerase sigma factor; Provisional 88.65
PRK12529178 RNA polymerase sigma factor; Provisional 88.62
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 88.61
PRK09644165 RNA polymerase sigma factor SigM; Provisional 88.59
PRK12516187 RNA polymerase sigma factor; Provisional 88.56
PRK09637181 RNA polymerase sigma factor SigZ; Provisional 88.56
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 88.54
TIGR02954169 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 88.53
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 88.51
TIGR02999183 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f 88.51
PRK09648189 RNA polymerase sigma factor SigD; Reviewed 88.47
PRK12514179 RNA polymerase sigma factor; Provisional 88.47
TIGR02974329 phageshock_pspF psp operon transcriptional activat 88.41
PRK12541161 RNA polymerase sigma factor; Provisional 88.4
TIGR02959170 SigZ RNA polymerase sigma factor, SigZ family. Thi 88.36
PRK0043095 fis global DNA-binding transcriptional dual regula 88.34
COG3413215 Predicted DNA binding protein [General function pr 88.32
PRK12533216 RNA polymerase sigma factor; Provisional 88.29
COG1961222 PinR Site-specific recombinases, DNA invertase Pin 88.28
PRK09047161 RNA polymerase factor sigma-70; Validated 88.26
PRK12547164 RNA polymerase sigma factor; Provisional 88.22
PRK12519194 RNA polymerase sigma factor; Provisional 88.19
PRK12523172 RNA polymerase sigma factor; Reviewed 88.18
PRK11050152 manganese transport regulator MntR; Provisional 88.16
PRK12542185 RNA polymerase sigma factor; Provisional 88.13
PRK12524196 RNA polymerase sigma factor; Provisional 88.05
COG1522154 Lrp Transcriptional regulators [Transcription] 88.04
PRK12526206 RNA polymerase sigma factor; Provisional 87.98
PF12298172 Bot1p: Eukaryotic mitochondrial regulator protein 87.98
PRK12537182 RNA polymerase sigma factor; Provisional 87.98
PRK09648189 RNA polymerase sigma factor SigD; Reviewed 87.96
PRK12530189 RNA polymerase sigma factor; Provisional 87.88
PRK09645173 RNA polymerase sigma factor SigL; Provisional 87.87
COG1710139 Uncharacterized protein conserved in archaea [Func 87.85
PRK12527159 RNA polymerase sigma factor; Reviewed 87.85
TIGR02954169 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 87.8
TIGR02983162 SigE-fam_strep RNA polymerase sigma-70 factor, sig 87.8
PRK08301234 sporulation sigma factor SigE; Reviewed 87.67
PF0012660 HTH_1: Bacterial regulatory helix-turn-helix prote 87.63
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 87.62
TIGR02947193 SigH_actino RNA polymerase sigma-70 factor, TIGR02 87.57
PF11198180 DUF2857: Protein of unknown function (DUF2857); In 87.54
PRK12516187 RNA polymerase sigma factor; Provisional 87.53
PRK10130350 transcriptional regulator EutR; Provisional 87.51
PRK09685302 DNA-binding transcriptional activator FeaR; Provis 87.44
PRK12522173 RNA polymerase sigma factor; Provisional 87.43
COG1595182 RpoE DNA-directed RNA polymerase specialized sigma 87.38
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 87.34
PRK03975141 tfx putative transcriptional regulator; Provisiona 87.34
TIGR02980227 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G 87.33
PF07638185 Sigma70_ECF: ECF sigma factor 87.33
PRK10783456 mltD membrane-bound lytic murein transglycosylase 87.3
PRK05602186 RNA polymerase sigma factor; Reviewed 87.29
PRK12542185 RNA polymerase sigma factor; Provisional 87.29
PRK12512184 RNA polymerase sigma factor; Provisional 87.27
PRK06811189 RNA polymerase factor sigma-70; Validated 87.26
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 87.24
PRK12540182 RNA polymerase sigma factor; Provisional 87.22
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 87.18
cd0009358 HTH_XRE Helix-turn-helix XRE-family like proteins. 87.17
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 87.13
PRK12525168 RNA polymerase sigma factor; Provisional 87.12
TIGR00721137 tfx DNA-binding protein, Tfx family. Tfx from Meth 87.1
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
Probab=99.20  E-value=2.2e-10  Score=90.02  Aligned_cols=90  Identities=18%  Similarity=0.378  Sum_probs=69.2

Q ss_pred             CCCHHHHHHHHHHHHcCCCCHHHHHHHhCCChHHHHHHHHHh--CCcccCCCCCCCCCCCHHHHHHHHHHHHhCCCcHHH
Q psy17316        118 SWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKE--GIRLAQPFNASPTAWKPEDLEIALEGIRSGQTTVQR  195 (229)
Q Consensus       118 kYs~e~k~~AV~~~~~g~~S~~~~a~k~gIp~sTL~~~ik~~--g~k~~~~~~~~~r~~t~e~r~eaV~~~~~~~~s~~e  195 (229)
                      .||.|++..+|..+..|+ |..+||..|+|+.+|+++|+++.  |-....|.  ..++.+.++..+.|+.  +.+.++.|
T Consensus         2 aYS~DlR~rVl~~~~~g~-s~~eaa~~F~VS~~Tv~~W~k~~~~G~~~~k~r--~~~Kid~~~L~~~v~~--~pd~tl~E   76 (119)
T PF01710_consen    2 AYSLDLRQRVLAYIEKGK-SIREAAKRFGVSRNTVYRWLKRKETGDLEPKPR--GRKKIDRDELKALVEE--NPDATLRE   76 (119)
T ss_pred             CCCHHHHHHHHHHHHccc-hHHHHHHHhCcHHHHHHHHHHhccccccccccc--ccccccHHHHHHHHHH--CCCcCHHH
Confidence            699999999999888877 99999999999999999999843  32211121  1115554444444443  36688999


Q ss_pred             HHHHhCCChHHHHHHHH
Q psy17316        196 ASAEYGIPSGTLYGRCK  212 (229)
Q Consensus       196 AA~~fgVp~~tv~~~vk  212 (229)
                      .|.+|||+.+||+..++
T Consensus        77 la~~l~Vs~~ti~~~Lk   93 (119)
T PF01710_consen   77 LAERLGVSPSTIWRALK   93 (119)
T ss_pred             HHHHcCCCHHHHHHHHH
Confidence            99999999999999998



This entry includes insertion sequences from Synechocystis sp. (strain PCC 6803) three of which are characterised as homologous to bacterial IS5- and IS4- and to several members of the IS630-Tc1-mariner superfamily []. More information about these proteins can be found at Protein of the Month: Transposase [].

>PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>COG2963 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA Back     alignment and domain information
>PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] Back     alignment and domain information
>PF09607 BrkDBD: Brinker DNA-binding domain; InterPro: IPR018586 This DNA-binding domain is the first approx Back     alignment and domain information
>cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>PF06056 Terminase_5: Putative ATPase subunit of terminase (gpP-like); InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after [] Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>PF13411 MerR_1: MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 Back     alignment and domain information
>cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators Back     alignment and domain information
>PRK13413 mpi multiple promoter invertase; Provisional Back     alignment and domain information
>PF13411 MerR_1: MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B Back     alignment and domain information
>cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators Back     alignment and domain information
>PF13565 HTH_32: Homeodomain-like domain Back     alignment and domain information
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>PHA02535 P terminase ATPase subunit; Provisional Back     alignment and domain information
>KOG4565|consensus Back     alignment and domain information
>PF09607 BrkDBD: Brinker DNA-binding domain; InterPro: IPR018586 This DNA-binding domain is the first approx Back     alignment and domain information
>PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] Back     alignment and domain information
>PRK11511 DNA-binding transcriptional activator MarA; Provisional Back     alignment and domain information
>PRK10219 DNA-binding transcriptional regulator SoxS; Provisional Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>smart00422 HTH_MERR helix_turn_helix, mercury resistance Back     alignment and domain information
>PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D Back     alignment and domain information
>cd04788 HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain of the transcription regulators NolA and AlbR Back     alignment and domain information
>PHA00675 hypothetical protein Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>PHA02535 P terminase ATPase subunit; Provisional Back     alignment and domain information
>KOG4565|consensus Back     alignment and domain information
>cd01105 HTH_GlnR-like Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators Back     alignment and domain information
>cd04788 HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain of the transcription regulators NolA and AlbR Back     alignment and domain information
>cd01106 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA Back     alignment and domain information
>smart00422 HTH_MERR helix_turn_helix, mercury resistance Back     alignment and domain information
>cd01105 HTH_GlnR-like Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators Back     alignment and domain information
>PF00292 PAX: 'Paired box' domain; InterPro: IPR001523 The paired box is a conserved 124 amino acid N-terminal domain of unknown function that usually, but not always, precedes a homeobox domain (see IPR001356 from INTERPRO) [, ] Back     alignment and domain information
>cd04765 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>cd04765 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>PRK13182 racA polar chromosome segregation protein; Reviewed Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>TIGR02531 yecD_yerC TrpR-related protein YerC/YecD Back     alignment and domain information
>TIGR01764 excise DNA binding domain, excisionase family Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>COG2826 Tra8 Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily Back     alignment and domain information
>PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] Back     alignment and domain information
>cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators Back     alignment and domain information
>PRK11511 DNA-binding transcriptional activator MarA; Provisional Back     alignment and domain information
>PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 Back     alignment and domain information
>PF02042 RWP-RK: RWP-RK domain; InterPro: IPR003035 This domain is named RWP-RK after a conserved motif at the C terminus of the domain Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>cd04782 HTH_BltR Helix-Turn-Helix DNA binding domain of the BltR transcription regulator Back     alignment and domain information
>PF13565 HTH_32: Homeodomain-like domain Back     alignment and domain information
>cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators Back     alignment and domain information
>cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators Back     alignment and domain information
>COG1342 Predicted DNA-binding proteins [General function prediction only] Back     alignment and domain information
>cd01106 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA Back     alignment and domain information
>PRK13413 mpi multiple promoter invertase; Provisional Back     alignment and domain information
>cd01109 HTH_YyaN Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB Back     alignment and domain information
>cd01282 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>TIGR02531 yecD_yerC TrpR-related protein YerC/YecD Back     alignment and domain information
>PF12728 HTH_17: Helix-turn-helix domain Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>cd00592 HTH_MerR-like Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>cd01110 HTH_SoxR Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator Back     alignment and domain information
>PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 Back     alignment and domain information
>PF13309 HTH_22: HTH domain Back     alignment and domain information
>cd01109 HTH_YyaN Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>cd01282 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PRK15044 transcriptional regulator SirC; Provisional Back     alignment and domain information
>PF07900 DUF1670: Protein of unknown function (DUF1670); InterPro: IPR012872 The hypothetical eukaryotic proteins found in this family are of unknown function Back     alignment and domain information
>PRK15186 AraC family transcriptional regulator; Provisional Back     alignment and domain information
>cd00592 HTH_MerR-like Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators Back     alignment and domain information
>cd01110 HTH_SoxR Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator Back     alignment and domain information
>cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators Back     alignment and domain information
>cd01107 HTH_BmrR Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator Back     alignment and domain information
>cd04790 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding domain of putative Cfa-like transcription regulators Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>PRK01905 DNA-binding protein Fis; Provisional Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>cd01107 HTH_BmrR Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator Back     alignment and domain information
>TIGR01764 excise DNA binding domain, excisionase family Back     alignment and domain information
>PRK10219 DNA-binding transcriptional regulator SoxS; Provisional Back     alignment and domain information
>cd04785 HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding domain of the CadR- and PbrR-like transcription regulators Back     alignment and domain information
>cd04780 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PRK13503 transcriptional activator RhaS; Provisional Back     alignment and domain information
>cd04774 HTH_YfmP Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator Back     alignment and domain information
>cd04782 HTH_BltR Helix-Turn-Helix DNA binding domain of the BltR transcription regulator Back     alignment and domain information
>cd04780 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>cd04789 HTH_Cfa Helix-Turn-Helix DNA binding domain of the Cfa transcription regulator Back     alignment and domain information
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily Back     alignment and domain information
>cd04773 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding domain of the regulatory protein TioE Back     alignment and domain information
>cd04789 HTH_Cfa Helix-Turn-Helix DNA binding domain of the Cfa transcription regulator Back     alignment and domain information
>cd04781 HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>cd04781 HTH_MerR-like_sg6 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK09978 DNA-binding transcriptional regulator GadX; Provisional Back     alignment and domain information
>PRK01381 Trp operon repressor; Provisional Back     alignment and domain information
>PF02001 DUF134: Protein of unknown function DUF134; InterPro: IPR002852 The bacterial and archaeal proteins in this family have no known function Back     alignment and domain information
>cd01108 HTH_CueR Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators Back     alignment and domain information
>PRK15185 transcriptional regulator HilD; Provisional Back     alignment and domain information
>cd01279 HTH_HspR-like Helix-Turn-Helix DNA binding domain of HspR-like transcription regulators Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>cd01111 HTH_MerD Helix-Turn-Helix DNA binding domain of the MerD transcription regulator Back     alignment and domain information
>cd04770 HTH_HMRTR Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators Back     alignment and domain information
>cd04773 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding domain of the regulatory protein TioE Back     alignment and domain information
>cd04774 HTH_YfmP Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>cd04767 HTH_HspR-like_MBC Helix-Turn-Helix DNA binding domain of putative HspR-like transcription regulators Back     alignment and domain information
>TIGR02043 ZntR Zn(II)-responsive transcriptional regulator Back     alignment and domain information
>cd01108 HTH_CueR Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators Back     alignment and domain information
>PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>cd04783 HTH_MerR1 Helix-Turn-Helix DNA binding domain of the MerR1 transcription regulator Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>PF12728 HTH_17: Helix-turn-helix domain Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>cd04769 HTH_MerR2 Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators Back     alignment and domain information
>PRK13182 racA polar chromosome segregation protein; Reviewed Back     alignment and domain information
>PRK15043 transcriptional regulator MirA; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02043 ZntR Zn(II)-responsive transcriptional regulator Back     alignment and domain information
>cd01279 HTH_HspR-like Helix-Turn-Helix DNA binding domain of HspR-like transcription regulators Back     alignment and domain information
>PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease Back     alignment and domain information
>cd04785 HTH_CadR-PbrR-like Helix-Turn-Helix DNA binding domain of the CadR- and PbrR-like transcription regulators Back     alignment and domain information
>TIGR02044 CueR Cu(I)-responsive transcriptional regulator Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>cd04770 HTH_HMRTR Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators Back     alignment and domain information
>cd04790 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding domain of putative Cfa-like transcription regulators Back     alignment and domain information
>TIGR02044 CueR Cu(I)-responsive transcriptional regulator Back     alignment and domain information
>PRK00430 fis global DNA-binding transcriptional dual regulator Fis; Provisional Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>cd04783 HTH_MerR1 Helix-Turn-Helix DNA binding domain of the MerR1 transcription regulator Back     alignment and domain information
>PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator Back     alignment and domain information
>PHA00675 hypothetical protein Back     alignment and domain information
>cd04786 HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>cd04769 HTH_MerR2 Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators Back     alignment and domain information
>PRK09514 zntR zinc-responsive transcriptional regulator; Provisional Back     alignment and domain information
>cd01111 HTH_MerD Helix-Turn-Helix DNA binding domain of the MerD transcription regulator Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA Back     alignment and domain information
>PRK09514 zntR zinc-responsive transcriptional regulator; Provisional Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PF00292 PAX: 'Paired box' domain; InterPro: IPR001523 The paired box is a conserved 124 amino acid N-terminal domain of unknown function that usually, but not always, precedes a homeobox domain (see IPR001356 from INTERPRO) [, ] Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>cd04767 HTH_HspR-like_MBC Helix-Turn-Helix DNA binding domain of putative HspR-like transcription regulators Back     alignment and domain information
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional Back     alignment and domain information
>cd04784 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain of the CadR and PbrR transcription regulators Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>TIGR02047 CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional regulator Back     alignment and domain information
>PF12833 HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_C 3OIO_A 1D5Y_B 3GBG_A 3OOU_A 1BL0_A 1XS9_A 3MN2_B 3MKL_B Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>COG1342 Predicted DNA-binding proteins [General function prediction only] Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02047 CadR-PbrR Cd(II)/Pb(II)-responsive transcriptional regulator Back     alignment and domain information
>PHA02591 hypothetical protein; Provisional Back     alignment and domain information
>PRK15043 transcriptional regulator MirA; Provisional Back     alignment and domain information
>COG0789 SoxR Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK15121 right oriC-binding transcriptional activator; Provisional Back     alignment and domain information
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator Back     alignment and domain information
>TIGR02051 MerR Hg(II)-responsive transcriptional regulator Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>PF02001 DUF134: Protein of unknown function DUF134; InterPro: IPR002852 The bacterial and archaeal proteins in this family have no known function Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>cd04786 HTH_MerR-like_sg7 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID Back     alignment and domain information
>TIGR01950 SoxR redox-sensitive transcriptional activator SoxR Back     alignment and domain information
>COG2826 Tra8 Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04776 HTH_GnyR Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR Back     alignment and domain information
>PF13022 HTH_Tnp_1_2: Helix-turn-helix of insertion element transposase; PDB: 2AO9_I Back     alignment and domain information
>COG2973 TrpR Trp operon repressor [Transcription] Back     alignment and domain information
>cd04787 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain of putative Heavy Metal Resistance transcription regulators Back     alignment and domain information
>PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease Back     alignment and domain information
>PRK09940 transcriptional regulator YdeO; Provisional Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator Back     alignment and domain information
>cd04784 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain of the CadR and PbrR transcription regulators Back     alignment and domain information
>cd04776 HTH_GnyR Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>cd04779 HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PRK15002 redox-sensitivie transcriptional activator SoxR; Provisional Back     alignment and domain information
>COG5484 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02054 MerD mercuric resistence transcriptional repressor protein MerD Back     alignment and domain information
>cd04779 HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PF03683 UPF0175: Uncharacterised protein family (UPF0175); InterPro: IPR005368 This entry contains small proteins of unknown function Back     alignment and domain information
>PRK10227 DNA-binding transcriptional regulator CueR; Provisional Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>PF09824 ArsR: ArsR transcriptional regulator; InterPro: IPR014517 Members of this family of archaeal proteins are conserved transcriptional regulators belonging to the ArsR family Back     alignment and domain information
>TIGR01950 SoxR redox-sensitive transcriptional activator SoxR Back     alignment and domain information
>TIGR02054 MerD mercuric resistence transcriptional repressor protein MerD Back     alignment and domain information
>PF06627 DUF1153: Protein of unknown function (DUF1153); InterPro: IPR009534 This family consists of several short, hypothetical bacterial proteins of unknown function Back     alignment and domain information
>PHA02943 hypothetical protein; Provisional Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>cd04778 HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) Back     alignment and domain information
>cd04787 HTH_HMRTR_unk Helix-Turn-Helix DNA binding domain of putative Heavy Metal Resistance transcription regulators Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PF03683 UPF0175: Uncharacterised protein family (UPF0175); InterPro: IPR005368 This entry contains small proteins of unknown function Back     alignment and domain information
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional Back     alignment and domain information
>TIGR03734 PRTRC_parB PRTRC system ParB family protein Back     alignment and domain information
>PRK01381 Trp operon repressor; Provisional Back     alignment and domain information
>PF08822 DUF1804: Protein of unknown function (DUF1804); InterPro: IPR014926 This entry is represented by Bacteriophage D3112, Orf24 Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>COG0789 SoxR Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK10227 DNA-binding transcriptional regulator CueR; Provisional Back     alignment and domain information
>PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) Back     alignment and domain information
>PRK15002 redox-sensitivie transcriptional activator SoxR; Provisional Back     alignment and domain information
>PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF13309 HTH_22: HTH domain Back     alignment and domain information
>PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) Back     alignment and domain information
>cd04777 HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PF03333 PapB: Adhesin biosynthesis transcription regulatory protein; InterPro: IPR004356 P pili, or fimbriae, are ~68A in diameter and 1 micron in length, the bulk of which is a fibre composed of the main structural protein PapA [] Back     alignment and domain information
>TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID Back     alignment and domain information
>TIGR02051 MerR Hg(II)-responsive transcriptional regulator Back     alignment and domain information
>PF13556 HTH_30: PucR C-terminal helix-turn-helix domain; PDB: 3ONQ_B Back     alignment and domain information
>PF14493 HTH_40: Helix-turn-helix domain Back     alignment and domain information
>PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>PRK15435 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase; Provisional Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>COG2207 AraC AraC-type DNA-binding domain-containing proteins [Transcription] Back     alignment and domain information
>PRK15044 transcriptional regulator SirC; Provisional Back     alignment and domain information
>PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) Back     alignment and domain information
>PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>PRK15186 AraC family transcriptional regulator; Provisional Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>COG3311 AlpA Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13752 putative transcriptional regulator MerR; Provisional Back     alignment and domain information
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>PRK13749 transcriptional regulator MerD; Provisional Back     alignment and domain information
>COG5484 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd04777 HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PF14493 HTH_40: Helix-turn-helix domain Back     alignment and domain information
>PF13556 HTH_30: PucR C-terminal helix-turn-helix domain; PDB: 3ONQ_B Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF08822 DUF1804: Protein of unknown function (DUF1804); InterPro: IPR014926 This entry is represented by Bacteriophage D3112, Orf24 Back     alignment and domain information
>PRK13752 putative transcriptional regulator MerR; Provisional Back     alignment and domain information
>cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins Back     alignment and domain information
>PF14549 P22_Cro: DNA-binding transcriptional regulator Cro; PDB: 1RZS_A 3BD1_A 3QWS_A 2HIN_B Back     alignment and domain information
>PF13443 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A Back     alignment and domain information
>PRK15185 transcriptional regulator HilD; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK09726 antitoxin HipB; Provisional Back     alignment and domain information
>cd04772 HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding domain of the regulatory protein TioE Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PF01418 HTH_6: Helix-turn-helix domain, rpiR family; InterPro: IPR000281 This domain contains a helix-turn-helix motif [] Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK09863 putative frv operon regulatory protein; Provisional Back     alignment and domain information
>PRK15435 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase; Provisional Back     alignment and domain information
>PF03374 ANT: Phage antirepressor protein KilAC domain; InterPro: IPR005039 This entry is represented by Bacteriophage P1, Ant1 C-terminal domain, which represents the processed Ant2 chain Back     alignment and domain information
>PF13443 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PF04936 DUF658: Protein of unknown function (DUF658); InterPro: IPR007020 This entry is represented by Bacteriophage r1t, Orf18 Back     alignment and domain information
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PF12844 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B Back     alignment and domain information
>PRK12537 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF05930 Phage_AlpA: Prophage CP4-57 regulatory protein (AlpA); InterPro: IPR010260 This entry is represents phage P4, Orf88 Back     alignment and domain information
>PF07900 DUF1670: Protein of unknown function (DUF1670); InterPro: IPR012872 The hypothetical eukaryotic proteins found in this family are of unknown function Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK09940 transcriptional regulator YdeO; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional Back     alignment and domain information
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA Back     alignment and domain information
>PRK09652 RNA polymerase sigma factor RpoE; Provisional Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PRK13503 transcriptional activator RhaS; Provisional Back     alignment and domain information
>PF12833 HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_C 3OIO_A 1D5Y_B 3GBG_A 3OOU_A 1BL0_A 1XS9_A 3MN2_B 3MKL_B Back     alignment and domain information
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional Back     alignment and domain information
>PRK01905 DNA-binding protein Fis; Provisional Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>COG2207 AraC AraC-type DNA-binding domain-containing proteins [Transcription] Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>COG2944 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13749 transcriptional regulator MerD; Provisional Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK10072 putative transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK09978 DNA-binding transcriptional regulator GadX; Provisional Back     alignment and domain information
>cd04772 HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding domain of the regulatory protein TioE Back     alignment and domain information
>PF05344 DUF746: Domain of Unknown Function (DUF746); InterPro: IPR008008 This is a short conserved region found in some transposons Back     alignment and domain information
>cd04778 HTH_MerR-like_sg2 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>PRK15340 transcriptional regulator InvF; Provisional Back     alignment and domain information
>COG2901 Fis Factor for inversion stimulation Fis, transcriptional activator [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF12298 Bot1p: Eukaryotic mitochondrial regulator protein ; InterPro: IPR021036 This entry represents Ribosomal protein S35, which localises to the mitochondria in live cells and co-fractionates with purified mitochondrial ribosomes Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK15418 transcriptional regulator LsrR; Provisional Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK10130 transcriptional regulator EutR; Provisional Back     alignment and domain information
>COG2973 TrpR Trp operon repressor [Transcription] Back     alignment and domain information
>COG2739 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family Back     alignment and domain information
>PF13022 HTH_Tnp_1_2: Helix-turn-helix of insertion element transposase; PDB: 2AO9_I Back     alignment and domain information
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>PRK12547 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK10072 putative transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>PRK11924 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PHA00738 putative HTH transcription regulator Back     alignment and domain information
>PRK09639 RNA polymerase sigma factor SigX; Provisional Back     alignment and domain information
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family Back     alignment and domain information
>COG2739 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09646 RNA polymerase sigma factor SigK; Reviewed Back     alignment and domain information
>TIGR02366 DHAK_reg probable dihydroxyacetone kinase regulator Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK06474 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 Back     alignment and domain information
>PF00376 MerR: MerR family regulatory protein; InterPro: IPR000551 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>TIGR03070 couple_hipB transcriptional regulator, y4mF family Back     alignment and domain information
>PF12759 HTH_Tnp_IS1: InsA C-terminal domain; InterPro: IPR024431 This entry represents the helix-turn-helix domain found at the C-terminal of InsA Back     alignment and domain information
>PF05930 Phage_AlpA: Prophage CP4-57 regulatory protein (AlpA); InterPro: IPR010260 This entry is represents phage P4, Orf88 Back     alignment and domain information
>PF06627 DUF1153: Protein of unknown function (DUF1153); InterPro: IPR009534 This family consists of several short, hypothetical bacterial proteins of unknown function Back     alignment and domain information
>PRK12520 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09047 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PHA02591 hypothetical protein; Provisional Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PRK09644 RNA polymerase sigma factor SigM; Provisional Back     alignment and domain information
>TIGR02607 antidote_HigA addiction module antidote protein, HigA family Back     alignment and domain information
>PRK13919 putative RNA polymerase sigma E protein; Provisional Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>PRK09415 RNA polymerase factor sigma C; Reviewed Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators Back     alignment and domain information
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family Back     alignment and domain information
>PF07638 Sigma70_ECF: ECF sigma factor Back     alignment and domain information
>PRK12543 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12540 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12532 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR00637 ModE_repress ModE molybdate transport repressor domain Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK15121 right oriC-binding transcriptional activator; Provisional Back     alignment and domain information
>PRK12539 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1 Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK05602 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK12527 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>PRK12514 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK12511 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF02042 RWP-RK: RWP-RK domain; InterPro: IPR003035 This domain is named RWP-RK after a conserved motif at the C terminus of the domain Back     alignment and domain information
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] Back     alignment and domain information
>COG1710 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK07037 extracytoplasmic-function sigma-70 factor; Validated Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK12536 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14549 P22_Cro: DNA-binding transcriptional regulator Cro; PDB: 1RZS_A 3BD1_A 3QWS_A 2HIN_B Back     alignment and domain information
>PF00440 TetR_N: Bacterial regulatory proteins, tetR family; InterPro: IPR001647 This entry represents a DNA-binding domain with a helix-turn-helix (HTH) structure that is found in several bacterial and archaeal transcriptional regulators, such as TetR, the tetracycline resistance repressor Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK15340 transcriptional regulator InvF; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK12530 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>PRK12519 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PRK09644 RNA polymerase sigma factor SigM; Provisional Back     alignment and domain information
>PRK12516 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09637 RNA polymerase sigma factor SigZ; Provisional Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family Back     alignment and domain information
>PRK09648 RNA polymerase sigma factor SigD; Reviewed Back     alignment and domain information
>PRK12514 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK12541 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02959 SigZ RNA polymerase sigma factor, SigZ family Back     alignment and domain information
>PRK00430 fis global DNA-binding transcriptional dual regulator Fis; Provisional Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>PRK12533 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1961 PinR Site-specific recombinases, DNA invertase Pin homologs [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09047 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PRK12547 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12519 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12523 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>PRK12542 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12524 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK12526 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF12298 Bot1p: Eukaryotic mitochondrial regulator protein ; InterPro: IPR021036 This entry represents Ribosomal protein S35, which localises to the mitochondria in live cells and co-fractionates with purified mitochondrial ribosomes Back     alignment and domain information
>PRK12537 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09648 RNA polymerase sigma factor SigD; Reviewed Back     alignment and domain information
>PRK12530 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09645 RNA polymerase sigma factor SigL; Provisional Back     alignment and domain information
>COG1710 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK12527 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family Back     alignment and domain information
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family Back     alignment and domain information
>PRK08301 sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>PF00126 HTH_1: Bacterial regulatory helix-turn-helix protein, lysR family; InterPro: IPR000847 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family Back     alignment and domain information
>PF11198 DUF2857: Protein of unknown function (DUF2857); InterPro: IPR021364 This is a bacterial family of uncharacterised proteins Back     alignment and domain information
>PRK12516 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK10130 transcriptional regulator EutR; Provisional Back     alignment and domain information
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional Back     alignment and domain information
>PRK12522 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>PF07638 Sigma70_ECF: ECF sigma factor Back     alignment and domain information
>PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional Back     alignment and domain information
>PRK05602 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK12542 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12512 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK06811 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>PRK12540 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR00721 tfx DNA-binding protein, Tfx family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
2cob_A70 LCOR protein; MLR2, KIAA1795, helix-turn-helix, st 2e-10
2cob_A70 LCOR protein; MLR2, KIAA1795, helix-turn-helix, st 7e-08
2cob_A70 LCOR protein; MLR2, KIAA1795, helix-turn-helix, st 1e-05
>2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 Length = 70 Back     alignment and structure
 Score = 54.4 bits (130), Expect = 2e-10
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 106 ANKASKAYGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTL-YKIARKEGIRLA 164
            +  S   G  + +N EIL  A+  + +G +S +KA   YGIP STL YK+  + G    
Sbjct: 1   GSSGSSGRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKN 60

Query: 165 QP 166
            P
Sbjct: 61  PP 62


>2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 Length = 70 Back     alignment and structure
>2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 Length = 70 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
1u78_A141 TC3 transposase, transposable element TC3 transpos 99.38
2k27_A159 Paired box protein PAX-8; paired domain, solution 99.37
1u78_A141 TC3 transposase, transposable element TC3 transpos 99.31
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 99.29
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 99.22
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 99.17
2cob_A70 LCOR protein; MLR2, KIAA1795, helix-turn-helix, st 99.16
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 99.11
2k27_A159 Paired box protein PAX-8; paired domain, solution 99.04
2cob_A70 LCOR protein; MLR2, KIAA1795, helix-turn-helix, st 98.9
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 98.7
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 98.61
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 98.52
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 98.51
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 98.49
2jrt_A95 Uncharacterized protein; solution, structure, NESG 98.48
2rn7_A108 IS629 ORFA; helix, all alpha, unknown function, st 98.47
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 98.35
2rn7_A108 IS629 ORFA; helix, all alpha, unknown function, st 98.3
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 98.28
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 98.26
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 98.24
2jrt_A95 Uncharacterized protein; solution, structure, NESG 98.21
3hot_A 345 Transposable element mariner, complete CDS; protei 98.2
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 98.05
3hot_A 345 Transposable element mariner, complete CDS; protei 98.05
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 98.05
2oa4_A101 SIR5; structure, structural genomics, PSI-2, prote 97.95
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 97.9
2oa4_A101 SIR5; structure, structural genomics, PSI-2, prote 97.78
2ao9_A155 Phage protein; structural genomics, nine-fold NCS. 97.66
4dyq_A140 Gene 1 protein; GP1, octamer, DNA-binding, viral p 97.66
2ao9_A155 Phage protein; structural genomics, nine-fold NCS. 97.47
3oou_A108 LIN2118 protein; protein structure initiative, PSI 97.36
3uj3_X193 DNA-invertase; helix-turn-helix, site-specific rec 97.36
3lsg_A103 Two-component response regulator YESN; structural 97.35
3e7l_A63 Transcriptional regulator (NTRC family); sigma43 a 97.23
3mn2_A108 Probable ARAC family transcriptional regulator; st 97.2
1g2h_A61 Transcriptional regulatory protein TYRR homolog; p 97.18
3mkl_A120 HTH-type transcriptional regulator GADX; PSI2, MCS 97.14
3oio_A113 Transcriptional regulator (ARAC-type DNA-binding c 97.11
4dyq_A140 Gene 1 protein; GP1, octamer, DNA-binding, viral p 97.09
2k9s_A107 Arabinose operon regulatory protein; activator, ar 97.07
1gdt_A183 GD resolvase, protein (gamma delta resolvase); pro 97.06
2r0q_C209 Putative transposon TN552 DNA-invertase BIN3; site 97.02
1umq_A81 Photosynthetic apparatus regulatory protein; DNA-b 96.97
3plo_X193 DNA-invertase; resolvase, helix-turn-helix, serine 96.91
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 96.89
1bl0_A129 Protein (multiple antibiotic resistance protein), 96.83
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 96.71
1ntc_A91 Protein (nitrogen regulation protein (NTRC)); heli 96.68
4ich_A311 Transcriptional regulator; structural genomics, PS 96.65
2jml_A81 DNA binding domain/transcriptional regulator; anti 96.56
1vz0_A230 PARB, chromosome partitioning protein PARB; nuclea 96.53
3lsg_A103 Two-component response regulator YESN; structural 96.44
1eto_A98 FIS, factor for inversion stimulation; transcripti 96.42
2jml_A81 DNA binding domain/transcriptional regulator; anti 96.38
3oou_A108 LIN2118 protein; protein structure initiative, PSI 96.34
3e7l_A63 Transcriptional regulator (NTRC family); sigma43 a 96.31
1iuf_A144 Centromere ABP1 protein; riken structural genomics 96.22
3gbg_A276 TCP pilus virulence regulatory protein; cupin, hel 96.18
3oio_A113 Transcriptional regulator (ARAC-type DNA-binding c 96.18
3mn2_A108 Probable ARAC family transcriptional regulator; st 96.16
4fcy_A 529 Transposase; rnaseh, DDE transposase, DNA binding 96.14
2vz4_A108 Tipal, HTH-type transcriptional activator TIPA; tr 95.95
3uj3_X193 DNA-invertase; helix-turn-helix, site-specific rec 95.91
1bl0_A129 Protein (multiple antibiotic resistance protein), 95.84
2k9s_A107 Arabinose operon regulatory protein; activator, ar 95.79
4fcy_A 529 Transposase; rnaseh, DDE transposase, DNA binding 95.73
1jhg_A101 Trp operon repressor; complex (regulatory protein- 95.65
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 95.6
1r8d_A109 Transcription activator MTAN; protein-DNA complex, 95.57
1iuf_A144 Centromere ABP1 protein; riken structural genomics 95.53
4fe7_A412 Xylose operon regulatory protein; HTH_ARAC, helix- 95.48
2vz4_A108 Tipal, HTH-type transcriptional activator TIPA; tr 95.34
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 95.32
3mkl_A120 HTH-type transcriptional regulator GADX; PSI2, MCS 95.31
1q06_A135 Transcriptional regulator CUER; MERR family transc 95.3
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 95.29
1umq_A81 Photosynthetic apparatus regulatory protein; DNA-b 95.27
3gp4_A142 Transcriptional regulator, MERR family; structural 95.04
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 95.01
1d5y_A 292 ROB transcription factor; protein-DNA complex, DNA 95.01
1r8d_A109 Transcription activator MTAN; protein-DNA complex, 95.01
1ntc_A91 Protein (nitrogen regulation protein (NTRC)); heli 94.99
1y0u_A96 Arsenical resistance operon repressor, putative; s 94.97
1g2h_A61 Transcriptional regulatory protein TYRR homolog; p 94.95
1j9i_A68 GPNU1 DBD;, terminase small subunit; DNA binding d 94.95
2l1p_A83 DNA-binding protein SATB1; PSI-biology, NESG, stru 94.95
1z4h_A66 TORI, TOR inhibition protein; winged helix, revers 94.9
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 94.84
1jhg_A101 Trp operon repressor; complex (regulatory protein- 94.83
3hh0_A146 Transcriptional regulator, MERR family; protein st 94.8
1q06_A135 Transcriptional regulator CUER; MERR family transc 94.73
3gp4_A142 Transcriptional regulator, MERR family; structural 94.65
1neq_A74 DNA-binding protein NER; NMR {Enterobacteria phage 94.53
1qbj_A81 Protein (double-stranded RNA specific adenosine D 94.5
2w7n_A101 TRFB transcriptional repressor protein; INCP, plas 94.44
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 94.43
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 94.43
2l0k_A93 Stage III sporulation protein D; SPOIIID, solution 94.42
3hh0_A146 Transcriptional regulator, MERR family; protein st 94.41
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 94.35
2hin_A71 GP39, repressor protein; transcription factor, dim 94.32
3plo_X193 DNA-invertase; resolvase, helix-turn-helix, serine 94.24
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 94.21
3gpv_A148 Transcriptional regulator, MERR family; protein st 94.16
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 94.16
3jth_A98 Transcription activator HLYU; transcription factor 94.16
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 94.12
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 94.09
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 94.01
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 93.93
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 93.91
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 93.9
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 93.86
3gpv_A148 Transcriptional regulator, MERR family; protein st 93.81
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 93.8
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 93.78
1y0u_A96 Arsenical resistance operon repressor, putative; s 93.77
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 93.76
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 93.74
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 93.67
2l0k_A93 Stage III sporulation protein D; SPOIIID, solution 93.67
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 93.65
1z4h_A66 TORI, TOR inhibition protein; winged helix, revers 93.51
2vxz_A 165 Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Py 93.48
1qbj_A81 Protein (double-stranded RNA specific adenosine D 93.46
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 93.4
2w7n_A101 TRFB transcriptional repressor protein; INCP, plas 93.39
2oqg_A114 Possible transcriptional regulator, ARSR family P; 93.37
3gbg_A276 TCP pilus virulence regulatory protein; cupin, hel 93.31
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 93.28
2zhg_A154 Redox-sensitive transcriptional activator SOXR; ox 93.27
1gdt_A183 GD resolvase, protein (gamma delta resolvase); pro 93.26
3kz3_A80 Repressor protein CI; five helix bundle, DNA-bindi 93.26
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 93.21
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 93.19
1eto_A98 FIS, factor for inversion stimulation; transcripti 93.19
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 93.19
2r0q_C209 Putative transposon TN552 DNA-invertase BIN3; site 93.13
2hin_A71 GP39, repressor protein; transcription factor, dim 93.12
3f6o_A118 Probable transcriptional regulator, ARSR family pr 93.04
2dg6_A 222 Putative transcriptional regulator; winged-helix m 93.04
2dg6_A222 Putative transcriptional regulator; winged-helix m 93.01
1zx4_A192 P1 PARB, plasmid partition PAR B protein, PARB; tr 93.0
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 92.99
3c57_A95 Two component transcriptional regulatory protein; 92.94
2pjp_A121 Selenocysteine-specific elongation factor; SELB, p 92.9
1d5y_A 292 ROB transcription factor; protein-DNA complex, DNA 92.89
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 92.86
2p5k_A64 Arginine repressor; DNA-binding domain, winged hel 92.85
2oqg_A114 Possible transcriptional regulator, ARSR family P; 92.85
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 92.8
3m8j_A111 FOCB protein; all-alpha, helix-turn-helix, transcr 92.78
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 92.77
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 92.69
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B302 92.64
2kko_A108 Possible transcriptional regulatory protein (possi 92.64
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 92.61
3frw_A107 Putative Trp repressor protein; structural genomic 92.61
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 92.59
2zhg_A154 Redox-sensitive transcriptional activator SOXR; ox 92.53
2cw1_A65 SN4M; lambda CRO fold, de novo protein; NMR {Synth 92.51
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 92.51
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding prote 92.49
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 92.42
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-h 92.39
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 92.38
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 92.22
1r71_A178 Transcriptional repressor protein KORB; INCP, plas 92.21
2p5k_A64 Arginine repressor; DNA-binding domain, winged hel 92.2
3kor_A119 Possible Trp repressor; putative DNA-binding Trp r 92.18
3qao_A249 LMO0526 protein, MERR-like transcriptional regulat 92.14
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 92.13
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 92.12
3jth_A98 Transcription activator HLYU; transcription factor 92.05
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 92.05
2kko_A108 Possible transcriptional regulatory protein (possi 91.99
3c57_A95 Two component transcriptional regulatory protein; 91.97
2wiu_B88 HTH-type transcriptional regulator HIPB; transfera 91.97
3kor_A119 Possible Trp repressor; putative DNA-binding Trp r 91.95
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 91.92
1j9i_A68 GPNU1 DBD;, terminase small subunit; DNA binding d 91.92
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 91.9
4fe7_A412 Xylose operon regulatory protein; HTH_ARAC, helix- 91.87
3frw_A107 Putative Trp repressor protein; structural genomic 91.8
2jt1_A77 PEFI protein; solution structure, winged helix-tur 91.79
2jt1_A77 PEFI protein; solution structure, winged helix-tur 91.74
2o3f_A111 Putative HTH-type transcriptional regulator YBBH; 91.71
1rzs_A61 Antirepressor, regulatory protein CRO; helix-turn- 91.69
2xi8_A66 Putative transcription regulator; HTH DNA-binding 91.62
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 91.54
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 91.5
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 91.47
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-h 91.46
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 91.45
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 91.42
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 91.17
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 91.16
2pij_A67 Prophage PFL 6 CRO; transcription factor, helix-tu 91.14
1lmb_392 Protein (lambda repressor); protein-DNA complex, d 91.07
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 91.06
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 90.98
3qao_A 249 LMO0526 protein, MERR-like transcriptional regulat 90.96
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2 90.8
3omt_A73 Uncharacterized protein; structural genomics, PSI- 90.8
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 90.73
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 90.71
3r0a_A123 Putative transcriptional regulator; structural gen 90.7
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 90.64
2l8n_A67 Transcriptional repressor CYTR; bacterial gene rep 90.63
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 90.61
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 90.6
1b0n_A111 Protein (SINR protein); transcription regulator, a 90.57
1ojl_A304 Transcriptional regulatory protein ZRAR; response 90.51
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 90.48
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 90.4
2w48_A 315 Sorbitol operon regulator; SORC, activator, repres 90.37
3bs3_A76 Putative DNA-binding protein; XRE-family, structur 90.36
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 90.36
2ofy_A86 Putative XRE-family transcriptional regulator; tra 90.34
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 90.3
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 90.28
3trb_A104 Virulence-associated protein I; mobIle and extrach 90.22
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 90.16
2ovg_A66 Phage lambda CRO; transcription factor, helix-turn 90.15
3op9_A114 PLI0006 protein; structural genomics, PSI-2, prote 90.08
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 90.07
2pij_A67 Prophage PFL 6 CRO; transcription factor, helix-tu 90.0
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 89.97
1sfx_A109 Conserved hypothetical protein AF2008; structural 89.95
1ojl_A304 Transcriptional regulatory protein ZRAR; response 89.93
1x57_A91 Endothelial differentiation-related factor 1; HMBF 89.92
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 89.87
3f6o_A118 Probable transcriptional regulator, ARSR family pr 89.85
3ivp_A126 Putative transposon-related DNA-binding protein; A 89.77
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2 89.72
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding prote 89.71
2xi8_A66 Putative transcription regulator; HTH DNA-binding 89.68
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 89.68
1neq_A74 DNA-binding protein NER; NMR {Enterobacteria phage 89.61
3f6v_A151 Possible transcriptional regulator, ARSR family pr 89.59
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 89.52
1sfx_A109 Conserved hypothetical protein AF2008; structural 89.51
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 89.47
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 89.43
2qlz_A232 Transcription factor PF0095; 2.50A {Pyrococcus fur 89.41
2a6c_A83 Helix-turn-helix motif; putative transcriptional r 89.41
2a6c_A83 Helix-turn-helix motif; putative transcriptional r 89.34
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 89.31
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-t 89.26
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 89.25
1j5y_A 187 Transcriptional regulator, biotin repressor famil; 89.21
4g6q_A 182 Putative uncharacterized protein; structural genom 89.19
1or7_A194 Sigma-24, RNA polymerase sigma-E factor; regulatio 89.18
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 89.0
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 88.99
3iwf_A107 Transcription regulator RPIR family; transcription 88.95
2w25_A150 Probable transcriptional regulatory protein; trans 88.94
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 88.87
3ppb_A195 Putative TETR family transcription regulator; DNA- 88.8
1j5y_A187 Transcriptional regulator, biotin repressor famil; 88.75
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, Pro binding 88.7
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1 88.64
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 88.56
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 88.54
3t76_A88 VANU, transcriptional regulator vanug; structural 88.47
1adr_A76 P22 C2 repressor; transcription regulation; NMR {E 88.42
1uly_A 192 Hypothetical protein PH1932; helix-turn-helix, str 88.39
2qko_A215 Possible transcriptional regulator, TETR family P; 88.37
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 88.3
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 88.29
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 88.24
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 88.21
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 88.21
2cw1_A65 SN4M; lambda CRO fold, de novo protein; NMR {Synth 88.21
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 88.12
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 88.06
2opt_A234 Actii protein; helical protein, TETR family, APO-p 88.01
3bs3_A76 Putative DNA-binding protein; XRE-family, structur 87.98
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 87.95
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG 87.93
1uly_A192 Hypothetical protein PH1932; helix-turn-helix, str 87.93
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-t 87.89
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 87.82
3dcf_A218 Transcriptional regulator of the TETR/ACRR family; 87.76
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 87.74
2ict_A94 Antitoxin HIGA; helix-turn-helix, structural genom 87.7
3omt_A73 Uncharacterized protein; structural genomics, PSI- 87.67
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 87.56
2k9q_A77 Uncharacterized protein; all helix, helix-turn-hel 87.54
3qkx_A188 Uncharacterized HTH-type transcriptional regulato; 87.54
3nxc_A212 HTH-type protein SLMA; nucleoid occlusion, cell di 87.53
3qq6_A78 HTH-type transcriptional regulator SINR; helix-tur 87.49
3bd1_A79 CRO protein; transcription factor, helix-turn-heli 87.44
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1 87.43
1ku9_A152 Hypothetical protein MJ223; putative transcription 87.38
3t72_q99 RNA polymerase sigma factor RPOD, DNA-directed RN 87.35
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 87.34
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-t 87.28
2w25_A150 Probable transcriptional regulatory protein; trans 87.13
2l1p_A83 DNA-binding protein SATB1; PSI-biology, NESG, stru 87.03
1r8e_A278 Multidrug-efflux transporter regulator; protein-DN 86.98
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 86.94
2yve_A185 Transcriptional regulator; helix-turn-helix, TETR- 86.9
3s8q_A82 R-M controller protein; protein-DNA complex, helix 86.86
2lfw_A157 PHYR sigma-like domain; signal transduction, respo 86.86
3i4p_A 162 Transcriptional regulator, ASNC family; PSI, struc 86.84
2g7g_A213 RHA04620, putative transcriptional regulator; heli 86.82
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 86.82
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-bindin 86.81
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 86.78
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 86.77
2hxi_A241 Putative transcriptional regulator; structural gen 86.77
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 86.76
2wiu_B88 HTH-type transcriptional regulator HIPB; transfera 86.68
3kxa_A141 NGO0477 protein, putative uncharacterized protein; 86.68
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 86.65
3r0a_A123 Putative transcriptional regulator; structural gen 86.63
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCS 86.63
4hku_A178 LMO2814 protein, TETR transcriptional regulator; s 86.62
2lfw_A157 PHYR sigma-like domain; signal transduction, respo 86.6
2l8n_A67 Transcriptional repressor CYTR; bacterial gene rep 86.6
2pz9_A226 Putative regulatory protein; structural genomics, 86.59
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 86.58
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 86.56
1sgm_A191 Putative HTH-type transcriptional regulator YXAF; 86.4
3dew_A206 Transcriptional regulator, TETR family; S genomics 86.38
3t72_q99 RNA polymerase sigma factor RPOD, DNA-directed RN 86.38
2xpw_A207 Tetracycline repressor protein class D; transcript 86.37
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 86.35
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 86.35
2p4w_A 202 Transcriptional regulatory protein ARSR family; ar 86.33
2ev1_A222 Hypothetical protein RV1264/MT1302; alpha-helical, 86.32
1adr_A76 P22 C2 repressor; transcription regulation; NMR {E 86.3
3fiw_A211 Putative TETR-family transcriptional regulator; TE 86.25
3kz3_A80 Repressor protein CI; five helix bundle, DNA-bindi 86.25
1or7_A194 Sigma-24, RNA polymerase sigma-E factor; regulatio 86.16
3egq_A170 TETR family transcriptional regulator; DNA-binding 85.99
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 85.96
3lfp_A98 CSP231I C protein; transcriptional regulator, DNA 85.91
1zk8_A183 Transcriptional regulator, TETR family; TETR membe 85.91
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH- 85.83
2dg7_A195 Putative transcriptional regulator; helix-turn-hel 85.79
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 85.74
1r8e_A 278 Multidrug-efflux transporter regulator; protein-DN 85.74
2qwt_A196 Transcriptional regulator, TETR family; structural 85.73
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 85.68
3iuo_A122 ATP-dependent DNA helicase RECQ; C-terminal, GI PS 85.41
2pjp_A121 Selenocysteine-specific elongation factor; SELB, p 85.4
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 85.36
3kz9_A206 SMCR; transcriptional regulator, quorum S DNA-bind 85.28
3bqz_B194 HTH-type transcriptional regulator QACR; multidrug 85.24
2q1z_A184 RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc 85.24
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, 85.19
3bd1_A79 CRO protein; transcription factor, helix-turn-heli 85.18
4ghj_A101 Probable transcriptional regulator; structural gen 85.17
2fq4_A192 Transcriptional regulator, TETR family; DNA-bindin 85.01
1b0n_A111 Protein (SINR protein); transcription regulator, a 84.97
3gzi_A218 Transcriptional regulator, TETR family; TETR famil 84.9
1zx4_A 192 P1 PARB, plasmid partition PAR B protein, PARB; tr 84.89
3by6_A126 Predicted transcriptional regulator; structural ge 84.86
1rzs_A61 Antirepressor, regulatory protein CRO; helix-turn- 84.84
2nnn_A140 Probable transcriptional regulator; structural gen 84.83
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG 84.8
1l3l_A234 Transcriptional activator protein TRAR; helix-turn 84.78
1jhf_A202 LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 84.72
3vp5_A189 Transcriptional regulator; heme, sensor protein, T 84.68
3k2z_A196 LEXA repressor; winged helix-turn-helix, SOS syste 84.65
2rae_A207 Transcriptional regulator, ACRR family protein; TE 84.65
2h09_A155 Transcriptional regulator MNTR; transcription regu 84.64
3f1b_A203 TETR-like transcriptional regulator; APC5888, rhod 84.63
4ac0_A202 Tetracycline repressor protein class B from trans 84.59
1z0x_A220 Transcriptional regulator, TETR family; structural 84.56
1vz0_A230 PARB, chromosome partitioning protein PARB; nuclea 84.54
3lwj_A202 Putative TETR-family transcriptional regulator; st 84.46
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 84.4
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 84.4
3lhq_A220 Acrab operon repressor (TETR/ACRR family); structu 84.4
3ljl_A156 Transcriptional regulator LUXT; structural genomic 84.31
3f6v_A151 Possible transcriptional regulator, ARSR family pr 84.29
2zcm_A192 Biofilm operon icaabcd HTH-type negative transcri 84.27
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-t 84.24
1v4r_A102 Transcriptional repressor; helix-turn-helix, winge 84.15
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 84.1
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 83.95
4aci_A191 HTH-type transcriptional repressor ACNR; aconitase 83.82
2qtq_A213 Transcriptional regulator, TETR family; transcript 83.77
3vpr_A190 Transcriptional regulator, TETR family; all alpha, 83.73
3qq6_A78 HTH-type transcriptional regulator SINR; helix-tur 83.65
3on4_A191 Transcriptional regulator, TETR family; structural 83.59
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-bindin 83.56
1y6u_A70 XIS, excisionase from transposon TN916; structure, 83.56
3o60_A185 LIN0861 protein; PSI, MCSG, structural genomics, m 83.48
2hxo_A237 Putative TETR-family transcriptional regulator; TE 83.45
3t76_A88 VANU, transcriptional regulator vanug; structural 83.41
2g7s_A194 Transcriptional regulator, TETR family; APC5906, P 83.4
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 83.37
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 83.34
2dg8_A193 Putative TETR-family transcriptional regulatory P; 83.34
2d6y_A202 Putative TETR family regulatory protein; helix-tur 83.29
3bjb_A207 Probable transcriptional regulator, TETR family P; 83.27
2np5_A203 Transcriptional regulator; TETR family, structural 83.26
2hku_A215 A putative transcriptional regulator; structural g 83.25
2jj7_A186 Hemolysin II regulatory protein; DNA-binding prote 83.24
3g5g_A99 Regulatory protein; transcriptional regulator, hel 83.2
2k9q_A77 Uncharacterized protein; all helix, helix-turn-hel 83.2
2o03_A131 Probable zinc uptake regulation protein FURB; DNA- 83.16
1pb6_A212 Hypothetical transcriptional regulator YCDC; helix 83.15
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 83.12
1u8b_A133 ADA polyprotein; protein-DNA complex, methylation, 83.1
2eh3_A179 Transcriptional regulator; all alpha proteins, tet 83.09
2wte_A244 CSA3; antiviral protein, viral resistance, winged 83.08
2guh_A214 Putative TETR-family transcriptional regulator; he 83.08
3pas_A195 TETR family transcription regulator; structural ge 83.07
2g7l_A243 TETR-family transcriptional regulator; APC6062, pr 83.06
3onq_A262 Regulator of polyketide synthase expression; struc 83.05
3bdd_A142 Regulatory protein MARR; putative multiple antibio 83.04
2dg7_A 195 Putative transcriptional regulator; helix-turn-hel 83.03
2w48_A 315 Sorbitol operon regulator; SORC, activator, repres 83.02
3vib_A 210 MTRR; helix-turn-helix motif, DNA binding, DNA bin 83.01
3col_A196 Putative transcription regulator; structural genom 82.94
2ia0_A 171 Putative HTH-type transcriptional regulator PF086; 82.91
3bja_A139 Transcriptional regulator, MARR family, putative; 82.89
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 82.88
3clo_A258 Transcriptional regulator; NP_811094.1, bacterial 82.87
2vpr_A207 Tetracycline resistance repressor protein; transcr 82.87
3f0c_A216 TETR-molecule A, transcriptional regulator; MCSG,P 82.83
2o7t_A199 Transcriptional regulator; transcription regulator 82.83
3ech_A142 MEXR, multidrug resistance operon repressor; winge 82.82
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 82.79
3u1d_A151 Uncharacterized protein; GNTR-superfamily, structu 82.73
2iu5_A195 DHAS, YCEG, HTH-type dhaklm operon transcriptional 82.72
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 82.69
3mvp_A217 TETR/ACRR transcriptional regulator; PSI, MCSG, st 82.65
3bdn_A236 Lambda repressor; repressor, allostery; HET: DNA; 82.62
1mkm_A 249 ICLR transcriptional regulator; structural genomic 82.6
1mkm_A249 ICLR transcriptional regulator; structural genomic 82.6
3rd3_A197 Probable transcriptional regulator; 2.40A {Pseudom 82.54
2ijl_A135 AGR_C_4647P, molybdenum-binding transcriptional re 82.53
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 82.5
3bqy_A209 Putative TETR family transcriptional regulator; st 82.48
3mnl_A203 KSTR, transcriptional regulatory protein (probably 82.4
3cec_A104 Putative antidote protein of plasmid maintenance; 82.39
3dpj_A194 Transcription regulator, TETR family; APC88616, si 82.39
3bni_A229 Putative TETR-family transcriptional regulator; st 82.39
3mlf_A111 Transcriptional regulator; structural genomics, he 82.37
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 82.34
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 82.34
1t33_A224 Putative transcriptional repressor (TETR/ACRR FAM; 82.32
3s8q_A82 R-M controller protein; protein-DNA complex, helix 82.31
1mzb_A136 Ferric uptake regulation protein; ferric uptake re 82.31
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 82.27
2fjr_A189 Repressor protein CI; genetic switch, regulation, 82.18
2q24_A194 Putative TETR family transcriptional regulator; st 82.15
3bru_A222 Regulatory protein, TETR family; structural genomi 82.12
2gen_A197 Probable transcriptional regulator; APC6095, TETR 82.11
1u8b_A133 ADA polyprotein; protein-DNA complex, methylation, 82.11
2eby_A113 Putative HTH-type transcriptional regulator YBAQ; 82.11
1x57_A91 Endothelial differentiation-related factor 1; HMBF 82.08
2fq4_A 192 Transcriptional regulator, TETR family; DNA-bindin 82.08
2q0o_A236 Probable transcriptional activator protein TRAR; h 82.05
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 82.03
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 82.02
2ict_A94 Antitoxin HIGA; helix-turn-helix, structural genom 82.01
3anp_C204 Transcriptional repressor, TETR family; all alpha 82.0
2q0o_A236 Probable transcriptional activator protein TRAR; h 81.85
3vk0_A114 NHTF, transcriptional regulator; HTH motif, XRE tr 81.81
3kkc_A177 TETR family transcriptional regulator; APC20805, s 81.68
2fe3_A145 Peroxide operon regulator; oxidative stress regula 81.67
3nnr_A228 Transcriptional regulator, TETR family; TETR-famil 81.64
3frq_A195 Repressor protein MPHR(A); macrolide antibiotic. r 81.57
3by6_A126 Predicted transcriptional regulator; structural ge 81.54
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B302 81.52
3knw_A212 Putative transcriptional regulator (TETR/ACRR FAM; 81.47
2xdn_A210 HTH-type transcriptional regulator TTGR; transcrip 81.47
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 81.45
3trb_A104 Virulence-associated protein I; mobIle and extrach 81.44
3hrs_A214 Metalloregulator SCAR; DTXR/MNTR family member, tr 81.44
3qkx_A188 Uncharacterized HTH-type transcriptional regulato; 81.42
2id3_A225 Putative transcriptional regulator; structural gen 81.4
3rqi_A184 Response regulator protein; structural genomics, s 81.38
2gxg_A146 146AA long hypothetical transcriptional regulator; 81.36
3m8j_A111 FOCB protein; all-alpha, helix-turn-helix, transcr 81.31
1lmb_392 Protein (lambda repressor); protein-DNA complex, d 81.27
2ibd_A204 Possible transcriptional regulator; probable trans 81.19
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 81.14
1j1v_A94 Chromosomal replication initiator protein DNAA, 5' 81.14
3cwr_A208 Transcriptional regulator, TETR family; YP_425770. 81.11
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 81.11
3sqn_A 485 Conserved domain protein; structural genomics, PSI 81.09
2zb9_A214 Putative transcriptional regulator; transcription 81.09
3rh2_A212 Hypothetical TETR-like transcriptional regulator; 81.07
3b81_A203 Transcriptional regulator, ACRR family; NP_350189. 81.06
2f07_A197 YVDT; helix-turn-helix, transcription; HET: BTB; 2 80.99
2pg4_A95 Uncharacterized protein; structural genomics, join 80.98
3s5r_A216 Transcriptional regulator TETR family; DNA/RNA-bin 80.95
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 80.84
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 80.8
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
Probab=99.38  E-value=9.1e-12  Score=96.83  Aligned_cols=99  Identities=8%  Similarity=-0.069  Sum_probs=81.8

Q ss_pred             cCCCCCCCHHHHHHHHHHHHcCCCCHHHHHHHhCCChHHHHHHHHHhCCcccCCCCCCCCCCCHHHHHHHHHHHHhCCCc
Q psy17316        113 YGPTKSWNEEILNVALDALRAGSISANKASKAYGIPSSTLYKIARKEGIRLAQPFNASPTAWKPEDLEIALEGIRSGQTT  192 (229)
Q Consensus       113 ~G~~~kYs~e~k~~AV~~~~~g~~S~~~~a~k~gIp~sTL~~~ik~~g~k~~~~~~~~~r~~t~e~r~eaV~~~~~~~~s  192 (229)
                      +|+++.|+.+++..++.++.+|. |..+||+.+||+.+|+++|++.+.........++++++++++...+++.+.++..+
T Consensus         1 Mgr~~~~s~~~r~~i~~~~~~G~-s~~~ia~~lgis~~Tv~r~~~~~~~~g~~~~~gr~~~l~~~~~~~i~~~~~~~~~s   79 (141)
T 1u78_A            1 MPRGSALSDTERAQLDVMKLLNV-SLHEMSRKISRSRHCIRVYLKDPVSYGTSKRAPRRKALSVRDERNVIRAASNSCKT   79 (141)
T ss_dssp             -CCSCCCCHHHHHHHHHHHHTTC-CHHHHHHHHTCCHHHHHHHHHSGGGTTCCCCCCCCCSSCHHHHHHHHHHHHHCCCC
T ss_pred             CCCcccCCHHHHHHHHHHHHcCC-CHHHHHHHHCcCHHHHHHHHHcccccCCcCCCCCCCcCCHHHHHHHHHHHhCCCCC
Confidence            36778899999999999997775 99999999999999999999865211111113556788999998898887778899


Q ss_pred             HHHHHHHhC--CChHHHHHHHH
Q psy17316        193 VQRASAEYG--IPSGTLYGRCK  212 (229)
Q Consensus       193 ~~eAA~~fg--Vp~~tv~~~vk  212 (229)
                      +.+++..||  ||++|||+|++
T Consensus        80 ~~~i~~~lg~~~s~~tV~r~l~  101 (141)
T 1u78_A           80 ARDIRNELQLSASKRTILNVIK  101 (141)
T ss_dssp             HHHHHHHTTCCSCHHHHHHHHH
T ss_pred             HHHHHHHHCCCccHHHHHHHHH
Confidence            999999999  89999999998



>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>2cob_A LCOR protein; MLR2, KIAA1795, helix-turn-helix, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.15 Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Back     alignment and structure
>2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Back     alignment and structure
>3hot_A Transposable element mariner, complete CDS; protein-DNA complex, synaptic complex, transposase, inverted DNA, DNA binding protein-DNA complex; HET: 5IU; 3.25A {Drosophila mauritiana} PDB: 3hos_A* Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>3hot_A Transposable element mariner, complete CDS; protein-DNA complex, synaptic complex, transposase, inverted DNA, DNA binding protein-DNA complex; HET: 5IU; 3.25A {Drosophila mauritiana} PDB: 3hos_A* Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 Back     alignment and structure
>2ao9_A Phage protein; structural genomics, nine-fold NCS., PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.90A {Bacillus cereus} SCOP: a.4.1.17 Back     alignment and structure
>4dyq_A Gene 1 protein; GP1, octamer, DNA-binding, viral protein; 1.50A {Shigella phage SF6} PDB: 4dyc_A 4dyr_A 3hef_A 4dzj_A 4dzp_A Back     alignment and structure
>2ao9_A Phage protein; structural genomics, nine-fold NCS., PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.90A {Bacillus cereus} SCOP: a.4.1.17 Back     alignment and structure
>3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} Back     alignment and structure
>3uj3_X DNA-invertase; helix-turn-helix, site-specific recombinase, recombination; 3.51A {Enterobacteria phage MU} PDB: 3plo_X Back     alignment and structure
>3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} Back     alignment and structure
>3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus} PDB: 4fth_A Back     alignment and structure
>3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>1g2h_A Transcriptional regulatory protein TYRR homolog; protein structure, , DNA-binding domain, helix- turn-helix motif; NMR {Haemophilus influenzae} SCOP: a.4.1.12 Back     alignment and structure
>3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} Back     alignment and structure
>3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} Back     alignment and structure
>4dyq_A Gene 1 protein; GP1, octamer, DNA-binding, viral protein; 1.50A {Shigella phage SF6} PDB: 4dyc_A 4dyr_A 3hef_A 4dzj_A 4dzp_A Back     alignment and structure
>2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} Back     alignment and structure
>1gdt_A GD resolvase, protein (gamma delta resolvase); protein-DNA complex, double helix, overhanging base, DNA binding protein/DNA complex; 3.00A {Escherichia coli} SCOP: a.4.1.2 c.53.1.1 PDB: 1zr4_A 1zr2_A 2gm4_A 1res_A 1ret_A Back     alignment and structure
>2r0q_C Putative transposon TN552 DNA-invertase BIN3; site-specific recombinase, resolvase, DNA-binding protein, protein-DNA complex, DNA integration, DNA invertase, DNA recombination; 3.20A {Staphylococcus aureus} Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>1ntc_A Protein (nitrogen regulation protein (NTRC)); helix-turn-helix, FIS, four-helix bundle, transcription regulation; NMR {Salmonella typhimurium} SCOP: a.4.1.12 Back     alignment and structure
>4ich_A Transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, transcription RE; 1.95A {Saccharomonospora viridis} Back     alignment and structure
>2jml_A DNA binding domain/transcriptional regulator; anti-repressor, MERR, carotenogenesis; HET: DNA; NMR {Myxococcus xanthus} Back     alignment and structure
>1vz0_A PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} SCOP: a.4.14.1 d.268.1.1 Back     alignment and structure
>3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} Back     alignment and structure
>1eto_A FIS, factor for inversion stimulation; transcriptional activation region, DNA-binding protein, transcription activator; 1.90A {Escherichia coli} SCOP: a.4.1.12 PDB: 1etq_A 1ety_A 1fia_A 3fis_A 3iv5_A* 3jr9_A* 3jra_A* 3jrb_A* 3jrc_A* 3jrd_A* 3jre_A* 3jrf_A* 3jrg_A* 3jrh_A* 3jri_A* 1f36_A 1etv_A 1etk_A 1etx_A 1fip_A ... Back     alignment and structure
>2jml_A DNA binding domain/transcriptional regulator; anti-repressor, MERR, carotenogenesis; HET: DNA; NMR {Myxococcus xanthus} Back     alignment and structure
>3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} Back     alignment and structure
>3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus} PDB: 4fth_A Back     alignment and structure
>1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} Back     alignment and structure
>3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>4fcy_A Transposase; rnaseh, DDE transposase, DNA binding protein-DNA complex; HET: DNA; 3.71A {Enterobacteria phage MU} PDB: 2ezk_A 2ezl_A 2ezh_A 2ezi_A Back     alignment and structure
>2vz4_A Tipal, HTH-type transcriptional activator TIPA; transcription, resistance, antibiotic; 2.90A {Streptomyces lividans} Back     alignment and structure
>3uj3_X DNA-invertase; helix-turn-helix, site-specific recombinase, recombination; 3.51A {Enterobacteria phage MU} PDB: 3plo_X Back     alignment and structure
>1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A Back     alignment and structure
>2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} Back     alignment and structure
>4fcy_A Transposase; rnaseh, DDE transposase, DNA binding protein-DNA complex; HET: DNA; 3.71A {Enterobacteria phage MU} PDB: 2ezk_A 2ezl_A 2ezh_A 2ezi_A Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>1r8d_A Transcription activator MTAN; protein-DNA complex, transcription/DNA complex; 2.70A {Bacillus subtilis} SCOP: a.6.1.3 PDB: 1jbg_A Back     alignment and structure
>1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 Back     alignment and structure
>4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A Back     alignment and structure
>2vz4_A Tipal, HTH-type transcriptional activator TIPA; transcription, resistance, antibiotic; 2.90A {Streptomyces lividans} Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} Back     alignment and structure
>1q06_A Transcriptional regulator CUER; MERR family transcriptional regulator, copper efflux regulator; 2.07A {Escherichia coli} SCOP: a.6.1.3 PDB: 1q05_A 1q07_A Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>3gp4_A Transcriptional regulator, MERR family; structural genomics, DNA-BI transcription regulator, PSI-2; 1.85A {Listeria monocytogenes str} Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>1d5y_A ROB transcription factor; protein-DNA complex, DNA, transcription/DNA complex; HET: DNA; 2.70A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 d.60.1.2 Back     alignment and structure
>1r8d_A Transcription activator MTAN; protein-DNA complex, transcription/DNA complex; 2.70A {Bacillus subtilis} SCOP: a.6.1.3 PDB: 1jbg_A Back     alignment and structure
>1ntc_A Protein (nitrogen regulation protein (NTRC)); helix-turn-helix, FIS, four-helix bundle, transcription regulation; NMR {Salmonella typhimurium} SCOP: a.4.1.12 Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>1g2h_A Transcriptional regulatory protein TYRR homolog; protein structure, , DNA-binding domain, helix- turn-helix motif; NMR {Haemophilus influenzae} SCOP: a.4.1.12 Back     alignment and structure
>1j9i_A GPNU1 DBD;, terminase small subunit; DNA binding domain, homodimer, viral assembly, winged helix-turn-helix, viral protein; NMR {Enterobacteria phage lambda} SCOP: a.6.1.5 Back     alignment and structure
>2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* Back     alignment and structure
>1z4h_A TORI, TOR inhibition protein; winged helix, reverse turn, protein binding, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>3hh0_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, 11183J, structural genomics; 2.67A {Bacillus cereus atcc 14579} Back     alignment and structure
>1q06_A Transcriptional regulator CUER; MERR family transcriptional regulator, copper efflux regulator; 2.07A {Escherichia coli} SCOP: a.6.1.3 PDB: 1q05_A 1q07_A Back     alignment and structure
>3gp4_A Transcriptional regulator, MERR family; structural genomics, DNA-BI transcription regulator, PSI-2; 1.85A {Listeria monocytogenes str} Back     alignment and structure
>1neq_A DNA-binding protein NER; NMR {Enterobacteria phage MU} SCOP: a.35.1.2 PDB: 1ner_A Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} Back     alignment and structure
>3hh0_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, 11183J, structural genomics; 2.67A {Bacillus cereus atcc 14579} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>2hin_A GP39, repressor protein; transcription factor, dimer interface, helix-turn-helix; 1.05A {Enterobacteria phage N15} PDB: 3qws_A Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>3gpv_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.90A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3gpv_A Transcriptional regulator, MERR family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.90A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>1z4h_A TORI, TOR inhibition protein; winged helix, reverse turn, protein binding, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>2vxz_A Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Pyrobaculum spherical virus} Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>2zhg_A Redox-sensitive transcriptional activator SOXR; oxidative stress, MERR family, activator; HET: DNA; 2.80A {Escherichia coli} PDB: 2zhh_A Back     alignment and structure
>1gdt_A GD resolvase, protein (gamma delta resolvase); protein-DNA complex, double helix, overhanging base, DNA binding protein/DNA complex; 3.00A {Escherichia coli} SCOP: a.4.1.2 c.53.1.1 PDB: 1zr4_A 1zr2_A 2gm4_A 1res_A 1ret_A Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1eto_A FIS, factor for inversion stimulation; transcriptional activation region, DNA-binding protein, transcription activator; 1.90A {Escherichia coli} SCOP: a.4.1.12 PDB: 1etq_A 1ety_A 1fia_A 3fis_A 3iv5_A* 3jr9_A* 3jra_A* 3jrb_A* 3jrc_A* 3jrd_A* 3jre_A* 3jrf_A* 3jrg_A* 3jrh_A* 3jri_A* 1f36_A 1etv_A 1etk_A 1etx_A 1fip_A ... Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>2r0q_C Putative transposon TN552 DNA-invertase BIN3; site-specific recombinase, resolvase, DNA-binding protein, protein-DNA complex, DNA integration, DNA invertase, DNA recombination; 3.20A {Staphylococcus aureus} Back     alignment and structure
>2hin_A GP39, repressor protein; transcription factor, dimer interface, helix-turn-helix; 1.05A {Enterobacteria phage N15} PDB: 3qws_A Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>2dg6_A Putative transcriptional regulator; winged-helix motif, MERR family, gene regulation; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>2dg6_A Putative transcriptional regulator; winged-helix motif, MERR family, gene regulation; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} Back     alignment and structure
>1d5y_A ROB transcription factor; protein-DNA complex, DNA, transcription/DNA complex; HET: DNA; 2.70A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 d.60.1.2 Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>3m8j_A FOCB protein; all-alpha, helix-turn-helix, transcription; 1.40A {Escherichia coli} Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>2zhg_A Redox-sensitive transcriptional activator SOXR; oxidative stress, MERR family, activator; HET: DNA; 2.80A {Escherichia coli} PDB: 2zhh_A Back     alignment and structure
>2cw1_A SN4M; lambda CRO fold, de novo protein; NMR {Synthetic} SCOP: k.46.1.1 Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1 Back     alignment and structure
>2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* Back     alignment and structure
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} Back     alignment and structure
>3qao_A LMO0526 protein, MERR-like transcriptional regulator; structural genomics, the center for structural genomics of I diseases, csgid; 1.87A {Listeria monocytogenes} Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Back     alignment and structure
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>1j9i_A GPNU1 DBD;, terminase small subunit; DNA binding domain, homodimer, viral assembly, winged helix-turn-helix, viral protein; NMR {Enterobacteria phage lambda} SCOP: a.6.1.5 Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A Back     alignment and structure
>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 Back     alignment and structure
>1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>3qao_A LMO0526 protein, MERR-like transcriptional regulator; structural genomics, the center for structural genomics of I diseases, csgid; 1.87A {Listeria monocytogenes} Back     alignment and structure
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>2l8n_A Transcriptional repressor CYTR; bacterial gene repressor, helix turn helix binding domain, L family, transcription regulation, binding protein; NMR {Escherichia coli} PDB: 2lcv_A Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>2ofy_A Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PS protein structure initiative; 1.70A {Rhodococcus SP} SCOP: a.35.1.3 Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>3trb_A Virulence-associated protein I; mobIle and extrachromosomal element functions, DNA binding P; 2.00A {Coxiella burnetii} Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>2ovg_A Phage lambda CRO; transcription factor, helix-turn-helix, bacteriophage, flexi transcription; 1.35A {Enterobacteria phage lambda} PDB: 2ecs_A 1cop_D 4cro_A* 5cro_O 1orc_A 2orc_A 2a63_A 1d1l_A 6cro_A* 3orc_A* 1d1m_B Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} Back     alignment and structure
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A Back     alignment and structure
>2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>1neq_A DNA-binding protein NER; NMR {Enterobacteria phage MU} SCOP: a.35.1.2 PDB: 1ner_A Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 Back     alignment and structure
>4g6q_A Putative uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.08A {Kribbella flavida} Back     alignment and structure
>1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure
>3iwf_A Transcription regulator RPIR family; transcriptional, N-terminal, PSI, MCSG, structural genomics, midwest center structural genomics; 1.40A {Staphylococcus epidermidis} Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>3ppb_A Putative TETR family transcription regulator; DNA-binding, helix-turn-helix motif, HTH motif, DNA/RNA-BIND helical bundle fold; HET: MSE PG4; 2.10A {Shewanella loihica} Back     alignment and structure
>1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 Back     alignment and structure
>2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>2qko_A Possible transcriptional regulator, TETR family P; TETR family protein, structural genomics, P protein structure initiative; 2.35A {Rhodococcus SP} Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2cw1_A SN4M; lambda CRO fold, de novo protein; NMR {Synthetic} SCOP: k.46.1.1 Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>2opt_A Actii protein; helical protein, TETR family, APO-protein, transcriptional R transcription; 2.05A {Streptomyces coelicolor} PDB: 3b6a_A* 3b6c_A* Back     alignment and structure
>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3dcf_A Transcriptional regulator of the TETR/ACRR family; YP_290855.1, structural genomics, joint center for structural genomics, JCSG; 2.50A {Thermobifida fusca YX} Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli} SCOP: a.35.1.3 PDB: 2icp_A Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qkx_A Uncharacterized HTH-type transcriptional regulato; structural genomics, joint center for structural genomics; HET: MSE; 2.35A {Haemophilus influenzae} Back     alignment and structure
>3nxc_A HTH-type protein SLMA; nucleoid occlusion, cell division, TETR family member, DNA B protein; 2.50A {Escherichia coli} Back     alignment and structure
>3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} Back     alignment and structure
>3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution, transcription; 1.40A {Xylella fastidiosa} Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* Back     alignment and structure
>1r8e_A Multidrug-efflux transporter regulator; protein-DNA complex, MERR-family transcription activator, MU binding protein; HET: P4P; 2.40A {Bacillus subtilis} SCOP: a.6.1.3 d.60.1.1 PDB: 1exi_A* 1exj_A* 3iao_A 3q5p_A* 3d71_A* 3q3d_A* 3q1m_A* 3q2y_A* 3q5r_A* 3q5s_A* 3d70_A 3d6z_A* 3d6y_A* 1bow_A 2bow_A* Back     alignment and structure
>2yve_A Transcriptional regulator; helix-turn-helix, TETR-family; HET: MBT; 1.40A {Corynebacterium glutamicum} PDB: 1v7b_A 2zoy_A 2yvh_A 2dh0_A* 2zoz_A* Back     alignment and structure
>3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* Back     alignment and structure
>2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2g7g_A RHA04620, putative transcriptional regulator; helix-turn-helix, structural genomics, PSI, protein structur initiative; 2.01A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>2hxi_A Putative transcriptional regulator; structural genomics, APC6293, TET streptomyces coelicolor A3(2), PSI-2; 1.70A {Streptomyces coelicolor} Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Back     alignment and structure
>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomic binding; 1.80A {Silicibacter pomeroyi} Back     alignment and structure
>4hku_A LMO2814 protein, TETR transcriptional regulator; structural genomics, PSI-biology; 2.30A {Listeria monocytogenes} Back     alignment and structure
>2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} Back     alignment and structure
>2l8n_A Transcriptional repressor CYTR; bacterial gene repressor, helix turn helix binding domain, L family, transcription regulation, binding protein; NMR {Escherichia coli} PDB: 2lcv_A Back     alignment and structure
>2pz9_A Putative regulatory protein; structural genomics, transcriptional regulator, PSI, protein structure initiative; 2.80A {Streptomyces coelicolor A3} Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1sgm_A Putative HTH-type transcriptional regulator YXAF; structural genomics, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3dew_A Transcriptional regulator, TETR family; S genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.75A {Geobacter sulfurreducens} Back     alignment and structure
>3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Back     alignment and structure
>2xpw_A Tetracycline repressor protein class D; transcription, transcription regulator, helix-turn-helix, ME coordination; HET: OTC MES; 1.44A {Escherichia coli} PDB: 1bjy_A* 1bj0_A 1du7_A* 1ork_A* 2fj1_A* 1bjz_A* 2o7o_A* 2x6o_A* 2x9d_A* 2xps_A* 2xpt_A* 2vke_A* 2xpu_A* 2xpv_A* 2tct_A* 2xb5_A* 2trt_A* 2xrl_A* 1qpi_A* 1a6i_A ... Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 Back     alignment and structure
>2ev1_A Hypothetical protein RV1264/MT1302; alpha-helical, regulatory domain of adenylyl cyclase, oleic lyase; HET: OLA 1PE; 1.60A {Mycobacterium tuberculosis} PDB: 2ev2_A* 2ev3_A* 2ev4_A* Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>3fiw_A Putative TETR-family transcriptional regulator; TETR-family transcriptional regulator streptomyces, structur genomics, PSI-2; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A Back     alignment and structure
>3egq_A TETR family transcriptional regulator; DNA-binding, transcription regulation, bacterial regulatory DNA/RNA-binding 3-helical bundle fold; HET: MSE PE8; 2.55A {Archaeoglobus fulgidus} Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>3lfp_A CSP231I C protein; transcriptional regulator, DNA binding protein, helix-turn-H restriction-modification, transcription; 2.00A {Citrobacter SP} PDB: 3lis_A Back     alignment and structure
>1zk8_A Transcriptional regulator, TETR family; TETR member,transcriptional regulator, STRU genomics, PSI, protein structure initiative; 2.15A {Bacillus cereus atcc 14579} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Back     alignment and structure
>2dg7_A Putative transcriptional regulator; helix-turn-helix motif, TETR family, gene regulation; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>1r8e_A Multidrug-efflux transporter regulator; protein-DNA complex, MERR-family transcription activator, MU binding protein; HET: P4P; 2.40A {Bacillus subtilis} SCOP: a.6.1.3 d.60.1.1 PDB: 1exi_A* 1exj_A* 3iao_A 3q5p_A* 3d71_A* 3q3d_A* 3q1m_A* 3q2y_A* 3q5r_A* 3q5s_A* 3d70_A 3d6z_A* 3d6y_A* 1bow_A 2bow_A* Back     alignment and structure
>2qwt_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium vanbaalenii pyr-1} Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>3iuo_A ATP-dependent DNA helicase RECQ; C-terminal, GI PSI, MCSG, structural genomics, midwest center for structur genomics; 1.60A {Porphyromonas gingivalis} Back     alignment and structure
>2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>3kz9_A SMCR; transcriptional regulator, quorum S DNA-binding, transcription regulation, transcription regula; HET: MSE; 2.10A {Vibrio vulnificus} PDB: 2pbx_A Back     alignment and structure
>3bqz_B HTH-type transcriptional regulator QACR; multidrug resistance, TETR, malachite green, DNA- binding, plasmid, repressor; HET: MGR; 2.17A {Staphylococcus aureus} PDB: 3br1_B* 3br3_B* 3pm1_B* 1rkw_B* 1jt0_A* 1jty_B* 1jum_B* 1jup_B* 1jtx_B* 1jus_B* 2dtz_B 2gby_B* 2hq5_B 3br2_B* 3br5_B* 1qvt_B* 1qvu_B* 3br0_B* 3br6_B* 1jt6_B* ... Back     alignment and structure
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Back     alignment and structure
>3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution, transcription; 1.40A {Xylella fastidiosa} Back     alignment and structure
>4ghj_A Probable transcriptional regulator; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE; 1.75A {Vibrio vulnificus} Back     alignment and structure
>2fq4_A Transcriptional regulator, TETR family; DNA-binding protein, bacillu structural genomics, PSI, protein structure initiative; 1.79A {Bacillus cereus} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A Back     alignment and structure
>3gzi_A Transcriptional regulator, TETR family; TETR family transcriptional regulator, structural genomics, center for structural genomics, JCSG; 2.05A {Shewanella loihica pv-4} Back     alignment and structure
>1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Back     alignment and structure
>1l3l_A Transcriptional activator protein TRAR; helix-turn-helix DNA binding motif, alpha/beta/alpha sandwich; HET: LAE; 1.66A {Agrobacterium tumefaciens} SCOP: a.4.6.2 d.110.5.1 PDB: 1h0m_A* Back     alignment and structure
>1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 3jso_A* 3jsp_A* 3k3r_E* 1jhc_A 1jhe_A 1lea_A 1leb_A Back     alignment and structure
>3vp5_A Transcriptional regulator; heme, sensor protein, TETR superf transcription; HET: HEM; 1.90A {Lactococcus lactis} PDB: 3vox_A 3vok_A* Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>2rae_A Transcriptional regulator, ACRR family protein; TETR/ACRR family transcriptional regulator, structural genom 2, RHA08332, MCSG; 2.20A {Rhodococcus SP} Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>3f1b_A TETR-like transcriptional regulator; APC5888, rhodococcus SP. RHA1, structural genomics, PS protein structure initiative; 2.40A {Rhodococcus} Back     alignment and structure
>4ac0_A Tetracycline repressor protein class B from trans TN1 0; transcription; HET: MIY; 2.45A {Escherichia coli} Back     alignment and structure
>1z0x_A Transcriptional regulator, TETR family; structural genomics, PSI, P structure initiative; 2.40A {Enterococcus faecalis} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>1vz0_A PARB, chromosome partitioning protein PARB; nuclear protein, chromosome segregation, DNA-binding, helix-turn-helix; 2.3A {Thermus thermophilus} SCOP: a.4.14.1 d.268.1.1 Back     alignment and structure
>3lwj_A Putative TETR-family transcriptional regulator; structural G joint center for structural genomics, JCSG, protein structu initiative; 2.07A {Syntrophomonas wolfei subsp} Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3lhq_A Acrab operon repressor (TETR/ACRR family); structural genomics, IDP02616, csgid, DNA-binding, transcription, transcription regulation; 1.56A {Salmonella enterica subsp} PDB: 3bcg_A 2qop_A Back     alignment and structure
>3ljl_A Transcriptional regulator LUXT; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 3.20A {Vibrio parahaemolyticus} Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>2zcm_A Biofilm operon icaabcd HTH-type negative transcri regulator ICAR; helix-turn-helix, TETR family, repressor; 1.33A {Staphylococcus epidermidis} PDB: 2zcn_A Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>4aci_A HTH-type transcriptional repressor ACNR; aconitase, citrate, TETR superfamily; HET: CIT; 1.65A {Corynebacterium glutamicum} PDB: 4ac6_A* Back     alignment and structure
>2qtq_A Transcriptional regulator, TETR family; transcription regulator, DNA/RNA-binding 3-helical bundle FO turn helix motif, HTH motif; HET: MSE; 1.85A {Novosphingobium aromaticivorans} PDB: 2rha_A* Back     alignment and structure
>3vpr_A Transcriptional regulator, TETR family; all alpha, helix-turn-helix, transcriptional repressor, DNA protein; 2.27A {Thermus thermophilus} Back     alignment and structure
>3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} Back     alignment and structure
>3on4_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: MSE; 1.85A {Legionella pneumophila subsp} Back     alignment and structure
>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} Back     alignment and structure
>1y6u_A XIS, excisionase from transposon TN916; structure, DNA architectural protein, tyrosine recombinase, winged-helix protein; NMR {Enterococcus faecalis} Back     alignment and structure
>3o60_A LIN0861 protein; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative, unknown function; 2.80A {Listeria innocua} Back     alignment and structure
>2hxo_A Putative TETR-family transcriptional regulator; TETR transcriptional regulator, structural genomics, PSI-2, structure initiative; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>2g7s_A Transcriptional regulator, TETR family; APC5906, PSI, protein structure initiat midwest center for structural genomics, MCSG; HET: MSE; 1.40A {Agrobacterium tumefaciens str} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2dg8_A Putative TETR-family transcriptional regulatory P; helix-turn-helix motif, gene regulation; 2.21A {Streptomyces coelicolor} Back     alignment and structure
>2d6y_A Putative TETR family regulatory protein; helix-turn-helix, gene regulation; HET: TLA; 2.30A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3bjb_A Probable transcriptional regulator, TETR family P; APC7331, rhodococcus SP. RHA1, structural genomics, PS protein structure initiative; 2.50A {Rhodococcus SP} Back     alignment and structure
>2np5_A Transcriptional regulator; TETR family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE LMT NDS; 1.80A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2hku_A A putative transcriptional regulator; structural genomics, APC6040, TET rhodococcus SP. RHA1, PSI-2, protein structure initiative; HET: PG4; 2.00A {Rhodococcus SP} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2jj7_A Hemolysin II regulatory protein; DNA-binding protein, transcription regulation, DNA-binding, family, transcription, transcriptional regulator; 2.10A {Bacillus cereus} PDB: 2wv1_A 2jk3_A 2fx0_A Back     alignment and structure
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Back     alignment and structure
>2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>1pb6_A Hypothetical transcriptional regulator YCDC; helix-loop-helix, dimer, structural genomics, PSI, protein structure initiative; 2.50A {Escherichia coli} PDB: 3loc_A* Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>1u8b_A ADA polyprotein; protein-DNA complex, methylation, zinc, helix-turn-helix, metal binding protein/DNA complex; 2.10A {Escherichia coli} PDB: 1zgw_A* 1wpk_A* 1adn_A 1eyf_A Back     alignment and structure
>2eh3_A Transcriptional regulator; all alpha proteins, tetracyclin repressor-like, C-terminal D homeodomain-like, DNA/RNA-binding 3-helical bundle; 1.55A {Aquifex aeolicus} Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2guh_A Putative TETR-family transcriptional regulator; helix-turn-helix, TETR fold, structural genomics, PSI, prote structure initiative; HET: MSE; 1.52A {Rhodococcus SP} Back     alignment and structure
>3pas_A TETR family transcription regulator; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>2g7l_A TETR-family transcriptional regulator; APC6062, protein structure initiativ midwest center for structural genomics, MCSG; 2.10A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3onq_A Regulator of polyketide synthase expression; structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Bifidobacterium adolescentis} Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>2dg7_A Putative transcriptional regulator; helix-turn-helix motif, TETR family, gene regulation; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3vib_A MTRR; helix-turn-helix motif, DNA binding, DNA binding protein; HET: CXS; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3col_A Putative transcription regulator; structural genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2vpr_A Tetracycline resistance repressor protein; transcription, metal-binding, antibiotic resistance, transcr regulator; HET: TDC; 2.49A {Pasteurella multocida} Back     alignment and structure
>3f0c_A TETR-molecule A, transcriptional regulator; MCSG,PSI, SAD, structural genomics, protein structure initiative; 2.96A {Cytophaga hutchinsonii} Back     alignment and structure
>2o7t_A Transcriptional regulator; transcription regulator, DNA/RNA-binding 3-helical bundle FO turn helix motif, HTH motif; HET: UNL; 2.10A {Corynebacterium glutamicum} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} Back     alignment and structure
>2iu5_A DHAS, YCEG, HTH-type dhaklm operon transcriptional activator; synthase, TETR family; 1.6A {Lactococcus lactis subsp} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>3mvp_A TETR/ACRR transcriptional regulator; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 1.85A {Streptococcus mutans} Back     alignment and structure
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>3rd3_A Probable transcriptional regulator; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2ijl_A AGR_C_4647P, molybdenum-binding transcriptional repressor; structural GE DNA-binding protein, PSI-2, PROT structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>3bqy_A Putative TETR family transcriptional regulator; structural genomics, strept coelicolor, PSI-2, protein structure initiative; 1.95A {Streptomyces coelicolor A3} Back     alignment and structure
>3mnl_A KSTR, transcriptional regulatory protein (probably TETR; TETR family of transcriptional regulator, all-helical; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3cec_A Putative antidote protein of plasmid maintenance; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.60A {Nostoc punctiforme} Back     alignment and structure
>3dpj_A Transcription regulator, TETR family; APC88616, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MES; 1.90A {Silicibacter pomeroyi} Back     alignment and structure
>3bni_A Putative TETR-family transcriptional regulator; structural genomics, APC7281; HET: PG4; 2.30A {Streptomyces coelicolor A3} Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>1t33_A Putative transcriptional repressor (TETR/ACRR FAM; structural genomics, TETR/CCRR FA helix turn helix DNA binding domain, PSI; 2.20A {Salmonella typhimurium} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* Back     alignment and structure
>1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 Back     alignment and structure
>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Back     alignment and structure
>2fjr_A Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A Back     alignment and structure
>2q24_A Putative TETR family transcriptional regulator; structural genomics, PSI, protein structure initiative; 1.80A {Streptomyces coelicolor A3} Back     alignment and structure
>3bru_A Regulatory protein, TETR family; structural genomics, APC88928, PSI-2, protein structur initiative; 2.30A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2gen_A Probable transcriptional regulator; APC6095, TETR family, structural genomics, PSI, protein structure initiative; 1.70A {Pseudomonas aeruginosa PAO1} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>1u8b_A ADA polyprotein; protein-DNA complex, methylation, zinc, helix-turn-helix, metal binding protein/DNA complex; 2.10A {Escherichia coli} PDB: 1zgw_A* 1wpk_A* 1adn_A 1eyf_A Back     alignment and structure
>2eby_A Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli} Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Back     alignment and structure
>2fq4_A Transcriptional regulator, TETR family; DNA-binding protein, bacillu structural genomics, PSI, protein structure initiative; 1.79A {Bacillus cereus} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli} SCOP: a.35.1.3 PDB: 2icp_A Back     alignment and structure
>3anp_C Transcriptional repressor, TETR family; all alpha protein, DNA, acyl-COA; HET: DCC DAO; 1.95A {Thermus thermophilus} PDB: 3ang_C* Back     alignment and structure
>2q0o_A Probable transcriptional activator protein TRAR; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP} Back     alignment and structure
>3vk0_A NHTF, transcriptional regulator; HTH motif, XRE transcription factor, DNA binding protein; 1.88A {Neisseria meningitidis} Back     alignment and structure
>3kkc_A TETR family transcriptional regulator; APC20805, structural genomics, PSI-2, protein structure initiative; 2.50A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure
>3nnr_A Transcriptional regulator, TETR family; TETR-family transcriptional regulator, structural genomics, center for structural genomics, JCSG; HET: MSE; 2.49A {Marinobacter aquaeolei} Back     alignment and structure
>3frq_A Repressor protein MPHR(A); macrolide antibiotic. repressor, biosensor, erythromycin, STRPTOMYCES, natural products, biosynthesis, DNA-binding; HET: ERY; 1.76A {Escherichia coli} PDB: 3g56_A Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Back     alignment and structure
>3knw_A Putative transcriptional regulator (TETR/ACRR FAM; TETR-like protein, MCSG, PSI, structural genomics, protein S initiative; 2.45A {Acinetobacter SP} Back     alignment and structure
>2xdn_A HTH-type transcriptional regulator TTGR; transcription regulation, TETR family; 2.20A {Pseudomonas putida} PDB: 2uxu_A* 2uxi_A* 2uxo_A* 2uxp_A* 2uxh_A* Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3trb_A Virulence-associated protein I; mobIle and extrachromosomal element functions, DNA binding P; 2.00A {Coxiella burnetii} Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>3qkx_A Uncharacterized HTH-type transcriptional regulato; structural genomics, joint center for structural genomics; HET: MSE; 2.35A {Haemophilus influenzae} Back     alignment and structure
>2id3_A Putative transcriptional regulator; structural genomics, PSI-2, prote structure initiative; 1.70A {Streptomyces coelicolor} SCOP: a.4.1.9 a.121.1.1 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3m8j_A FOCB protein; all-alpha, helix-turn-helix, transcription; 1.40A {Escherichia coli} Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Back     alignment and structure
>2ibd_A Possible transcriptional regulator; probable transcriptional regulatory protein, rhodococcus SP. structural genomics, PSI-2; 1.50A {Rhodococcus SP} Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>1j1v_A Chromosomal replication initiator protein DNAA, 5'-D(*CP*CP*TP*GP*TP*GP*GP*AP*TP*AP*AP*CP*A)-3'; protein-DNA complex; 2.10A {Escherichia coli} SCOP: a.4.12.2 Back     alignment and structure
>3cwr_A Transcriptional regulator, TETR family; YP_425770.1, transcriptional regulator of TETR family, bacterial regulatory proteins; 1.50A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3sqn_A Conserved domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MGA family; 2.31A {Enterococcus faecalis} Back     alignment and structure
>2zb9_A Putative transcriptional regulator; transcription regulator, TETR family, helix-turn-helix, DNA- binding, transcription regulation; 2.25A {Streptomyces coelicolor} Back     alignment and structure
>3rh2_A Hypothetical TETR-like transcriptional regulator; DNA/RNA-binding 3-helical bundle, structural genomics, joint for structural genomics; 2.42A {Shewanella amazonensis} Back     alignment and structure
>3b81_A Transcriptional regulator, ACRR family; NP_350189.1, predicted DNA-binding transcriptional regulator TETR/ACRR family; 2.10A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2f07_A YVDT; helix-turn-helix, transcription; HET: BTB; 2.30A {Bacillus subtilis subsp} Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>3s5r_A Transcriptional regulator TETR family; DNA/RNA-binding 3-helical bundle, tetracyclin repressor-like structural genomics; 2.60A {Syntrophus aciditrophicus} Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 229
d2coba163 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LC 8e-05
d2coba163 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LC 3e-04
>d2coba1 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LCoR) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Psq domain
domain: Ligand-dependent corepressor (LCoR)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.7 bits (87), Expect = 8e-05
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 31 KTWTHEDMDAALEALRAGQMSLTKASVSYGIPSTTL-WQRAHRLG-IHTPKKEGP 83
          + +  E ++ A+  + +G+MS++KA   YGIP +TL ++   RLG +  P K+  
Sbjct: 5  RQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKM 59


>d2coba1 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LCoR) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 98.84
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 98.76
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 98.46
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 98.44
d1hlva166 DNA-binding domain of centromere binding protein B 98.29
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 98.27
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 98.17
d2coba163 Ligand-dependent corepressor (LCoR) {Human (Homo s 98.11
d1k78a163 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d2coba163 Ligand-dependent corepressor (LCoR) {Human (Homo s 98.06
d1hlva166 DNA-binding domain of centromere binding protein B 97.98
d1k78a163 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1umqa_60 Photosynthetic apparatus regulatory protein PprA ( 97.68
d2oa4a193 Uncharacterized protein SPO1678 {Silicibacter pome 97.56
d1g2ha_61 Transcriptional regulator TyrR, C-terminal domain 97.37
d1vz0a193 Putative partitioning protein ParB/Spo0J {Thermus 97.0
d1etxa_89 FIS protein {Escherichia coli [TaxId: 562]} 96.92
d2oa4a193 Uncharacterized protein SPO1678 {Silicibacter pome 96.8
d1ntca_91 DNA-binding domain of NTRC {Salmonella typhimurium 96.79
d1umqa_60 Photosynthetic apparatus regulatory protein PprA ( 96.52
d1gdta143 gamma,delta resolvase (C-terminal domain) {Escheri 96.45
d1g2ha_61 Transcriptional regulator TyrR, C-terminal domain 96.21
d1gdta143 gamma,delta resolvase (C-terminal domain) {Escheri 95.93
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 95.79
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 95.22
d1q06a_127 Transcriptional regulator CueR {Escherichia coli [ 95.09
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 95.08
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 95.04
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 94.9
d1r8da_109 Multidrug transporter activator MtaN {Bacillus sub 94.89
d1q06a_127 Transcriptional regulator CueR {Escherichia coli [ 94.86
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 94.79
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 94.65
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.55
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 94.46
d1r8da_109 Multidrug transporter activator MtaN {Bacillus sub 94.44
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 94.44
d1utxa_66 Putative transcription regulator CylR2 {Enterococc 94.42
d2b5aa177 Regulatory protein C.BclI {Bacillus caldolyticus [ 94.38
d1etxa_89 FIS protein {Escherichia coli [TaxId: 562]} 94.35
d1jhga_101 Trp repressor, TrpR {Escherichia coli [TaxId: 562] 94.15
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 94.14
d2p4wa1 194 Transcriptional regulatory protein PF1790 {Pyrococ 93.79
d1r8ea1118 Transcription activator BmrR {Bacillus subtilis [T 93.74
d1jhga_101 Trp repressor, TrpR {Escherichia coli [TaxId: 562] 93.71
d1r8ea1118 Transcription activator BmrR {Bacillus subtilis [T 93.51
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tum 93.49
d2ezla_99 Ibeta subdomain of the mu end DNA-binding domain o 93.47
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 93.44
d1ulya_ 190 Hypothetical protein PH1932 {Pyrococcus horikoshii 93.39
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 93.36
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 93.32
d1r71a_114 Transcriptional repressor protein KorB DNA-binding 93.21
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 93.17
d2ao9a1120 Phage protein BC1890 {Bacillus cereus [TaxId: 1396 92.87
d2ezla_99 Ibeta subdomain of the mu end DNA-binding domain o 92.85
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 92.82
d1ntca_91 DNA-binding domain of NTRC {Salmonella typhimurium 92.74
d1z0xa168 Transcriptional regulator EF0787 {Enterococcus fae 92.73
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 92.56
d2g7la168 Putative transcriptional regulator SCO7704 {Strept 92.52
d2r1jl166 P22 C2 repressor, DNA-binding domain {Salmonella b 92.51
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.48
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophag 92.48
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureu 92.4
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 92.32
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 92.24
d2g7ga165 Putative transcriptional regulator Rha04620 {Rhodo 92.24
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 92.14
d1mkma175 Transcriptional regulator IclR, N-terminal domain 91.92
d2o3fa183 Putative transcriptional regulator YbbH {Bacillus 91.85
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas pal 91.85
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogen 91.8
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 91.53
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nit 91.49
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 91.43
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureu 91.33
d2np5a169 Transcriptional regulator RHA1_ro04179 {Rhodococcu 91.27
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 91.24
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nit 91.2
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 91.05
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 90.79
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 90.64
d2i10a169 Putative transcriptional regulator RHA1_ro09068 {R 90.62
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 90.6
d1yioa170 Response regulatory protein StyR, C-terminal domai 90.58
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [T 90.52
d1qpza157 Purine repressor (PurR), N-terminal domain {Escher 90.5
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogen 90.47
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 90.36
d1y9qa179 Probable transcriptional regulator VC1968, N-termi 90.34
d1mkma175 Transcriptional regulator IclR, N-terminal domain 90.22
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 90.15
d2fbqa179 Transcriptional regulator PsrA {Pseudomonas aerugi 90.02
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [T 89.94
d1t56a173 Ethr repressor {Mycobacterium tuberculosis [TaxId: 89.88
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas pal 89.85
d2gfna177 Probable transcriptional regulator RHA1_ro04631 {R 89.8
d1qpza157 Purine repressor (PurR), N-terminal domain {Escher 89.67
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 89.63
d1efaa159 Lac repressor (LacR), N-terminal domain {Escherich 89.59
d1b0na268 SinR repressor, DNA-binding domain {Bacillus subti 89.5
d1jt6a171 Multidrug binding protein QacR {Staphylococcus aur 89.46
d2icta187 Antitoxin HigA {Escherichia coli [TaxId: 562]} 89.37
d2iu5a171 Transcriptional activator DhaS {Lactococcus lactis 89.34
d1uxda_59 Fructose repressor (FruR), N-terminal domain {Esch 89.33
d2gena170 Probable transcriptional regulator PA1836 {Pseudom 89.24
d1vz0a193 Putative partitioning protein ParB/Spo0J {Thermus 89.13
d1zk8a172 Transcriptional regulator BC5000 {Bacillus cereus 89.01
d2fq4a169 Transcriptional regulator BC3163 {Bacillus cereus 89.0
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 88.91
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 88.85
d1nera_74 Ner {Bacteriophage mu [TaxId: 10677]} 88.8
d1v7ba174 Transcriptional regulator Cgl2612 {Corynebacterium 88.8
d2vkva162 Tetracyclin repressor (Tet-repressor, TetR) {Esche 88.76
d1pb6a172 Hypothetical transcriptional regulator YcdC {Esche 88.75
d2hkua170 Putative transcriptional regulator RHA1_ro03468 {R 88.73
d2g7sa174 Putative transcriptional regulator Atu0279 {Agroba 88.66
d1ui5a171 A-factor receptor homolog CprB {Streptomyces coeli 88.63
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 88.51
d1y7ya169 Restriction-modification controller protein C.AhdI 88.43
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 88.43
d1ulya_190 Hypothetical protein PH1932 {Pyrococcus horikoshii 88.38
d3c07a175 Putative transcriptional regulator SCO4850 {Strept 88.25
d1b0na268 SinR repressor, DNA-binding domain {Bacillus subti 88.08
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tum 88.07
d2o7ta178 Transcriptional regulator Cgl1640/Cg1846 {Coryneba 87.96
d2b5aa177 Regulatory protein C.BclI {Bacillus caldolyticus [ 87.92
d2i10a169 Putative transcriptional regulator RHA1_ro09068 {R 87.84
d1yioa170 Response regulatory protein StyR, C-terminal domai 87.78
d1utxa_66 Putative transcription regulator CylR2 {Enterococc 87.76
d2icta187 Antitoxin HigA {Escherichia coli [TaxId: 562]} 87.67
d2hoea162 N-acetylglucosamine kinase {Thermotoga maritima [T 87.53
d2d6ya168 Putative regulator SCO4008 {Streptomyces coelicolo 87.51
d1sgma173 Putative transcriptional regulator YxaF {Bacillus 87.51
d1efaa159 Lac repressor (LacR), N-terminal domain {Escherich 87.44
d1lmb3_87 lambda C1 repressor, DNA-binding domain {Bacteriop 87.36
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 87.36
d2fx0a173 Hemolysin II regulatory protein, HlyIIR {Bacillus 87.21
d2esna189 Probable LysR-type transcriptional regulator PA047 87.16
d2gena170 Probable transcriptional regulator PA1836 {Pseudom 87.11
d2hoea162 N-acetylglucosamine kinase {Thermotoga maritima [T 87.06
d1t56a173 Ethr repressor {Mycobacterium tuberculosis [TaxId: 86.99
d2id3a168 Putative transcriptional regulator SCO5951 {Strept 86.95
d2p4wa1194 Transcriptional regulatory protein PF1790 {Pyrococ 86.88
d1bl0a262 MarA {Escherichia coli [TaxId: 562]} 86.68
d1pb6a172 Hypothetical transcriptional regulator YcdC {Esche 86.62
d1d5ya154 Rob transcription factor, N-terminal domain {Esche 86.51
d1jt6a171 Multidrug binding protein QacR {Staphylococcus aur 86.23
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 86.19
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 85.76
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophag 85.73
d3c07a175 Putative transcriptional regulator SCO4850 {Strept 85.69
d2g3ba172 Putative transcriptional regulator {Rhodococcus sp 85.65
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 85.61
d2ao9a1120 Phage protein BC1890 {Bacillus cereus [TaxId: 1396 85.52
d1b9ma1127 N-terminal domain of molybdate-dependent transcrip 85.48
d2g7ga165 Putative transcriptional regulator Rha04620 {Rhodo 85.34
d2o7ta178 Transcriptional regulator Cgl1640/Cg1846 {Coryneba 85.31
d1p4wa_87 Transcriptional regulator RcsB {Erwinia amylovora 85.24
d2hkua170 Putative transcriptional regulator RHA1_ro03468 {R 85.14
d2hyja175 Putative transcriptional regulator SCO4940 {Strept 85.14
d1vi0a172 Hypothetical transcriptional regulator YsiA {Bacil 84.84
d2r1jl166 P22 C2 repressor, DNA-binding domain {Salmonella b 84.83
d2gfna177 Probable transcriptional regulator RHA1_ro04631 {R 84.76
d1v7ba174 Transcriptional regulator Cgl2612 {Corynebacterium 84.58
d2g7sa174 Putative transcriptional regulator Atu0279 {Agroba 84.55
d2id6a175 Transcriptional regulator TM1030 {Thermotoga marit 84.33
d2oi8a179 Putative regulatory protein Sco4313 {Streptomyces 84.28
d1ixca189 LysR-type regulatory protein CbnR {Ralstonia eutro 84.28
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 84.26
d1x57a178 Endothelial differentiation-related factor 1, EDF1 84.0
d1j9ia_68 Terminase gpNU1 subunit domain {Bacteriophage lamb 83.93
d2fd5a176 Probable transcriptional regulator PA3133 {Pseudom 83.71
d2vkva162 Tetracyclin repressor (Tet-repressor, TetR) {Esche 83.7
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 83.66
d2d6ya168 Putative regulator SCO4008 {Streptomyces coelicolo 83.49
d2fq4a169 Transcriptional regulator BC3163 {Bacillus cereus 83.08
d1rr7a_94 Middle operon regulator, Mor {Bacteriophage Mu [Ta 82.99
d1y9qa179 Probable transcriptional regulator VC1968, N-termi 82.96
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 82.88
d2fx0a173 Hemolysin II regulatory protein, HlyIIR {Bacillus 82.86
d2o3fa183 Putative transcriptional regulator YbbH {Bacillus 82.63
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 82.61
d2fbqa179 Transcriptional regulator PsrA {Pseudomonas aerugi 82.59
d1r71a_114 Transcriptional repressor protein KorB DNA-binding 82.55
d2np5a169 Transcriptional regulator RHA1_ro04179 {Rhodococcu 82.53
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 82.41
d1vi0a172 Hypothetical transcriptional regulator YsiA {Bacil 82.39
d1p4wa_87 Transcriptional regulator RcsB {Erwinia amylovora 82.21
d1y7ya169 Restriction-modification controller protein C.AhdI 82.08
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 82.01
d1ui5a171 A-factor receptor homolog CprB {Streptomyces coeli 81.99
d1bl0a262 MarA {Escherichia coli [TaxId: 562]} 81.98
d2g3ba172 Putative transcriptional regulator {Rhodococcus sp 81.86
d1z0xa168 Transcriptional regulator EF0787 {Enterococcus fae 81.78
d1rkta181 Hypothetical transcriptional regulator YfiR {Bacil 81.77
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 81.68
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 81.5
d1sgma173 Putative transcriptional regulator YxaF {Bacillus 81.44
d1uxda_59 Fructose repressor (FruR), N-terminal domain {Esch 81.14
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 81.13
d1hw1a174 Fatty acid responsive transcription factor FadR, N 80.93
d2id6a175 Transcriptional regulator TM1030 {Thermotoga marit 80.82
d1ic8a294 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (H 80.76
d1rr7a_94 Middle operon regulator, Mor {Bacteriophage Mu [Ta 80.3
d2id3a168 Putative transcriptional regulator SCO5951 {Strept 80.28
d1d5ya154 Rob transcription factor, N-terminal domain {Esche 80.1
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Cgl2762-like
domain: Uncharacterized protein Cgl2762
species: Corynebacterium glutamicum [TaxId: 1718]
Probab=98.84  E-value=5.6e-09  Score=75.02  Aligned_cols=54  Identities=22%  Similarity=0.195  Sum_probs=47.1

Q ss_pred             CCCCCCHHHHHHHHHHHHc-CCCCHHHHHHHcCCChhhHHHHHHHhCCCCCCCCC
Q psy17316         29 VTKTWTHEDMDAALEALRA-GQMSLTKASVSYGIPSTTLWQRAHRLGIHTPKKEG   82 (229)
Q Consensus        29 ~~~kyt~e~~~~AI~~~~~-g~~S~~~aA~~~gIp~sTL~~~i~~~gi~~~~~~~   82 (229)
                      .+++||.|.+.+||+++.+ +|.|+.++|++|||+.+||++|+++|+..+.....
T Consensus         2 ~rk~Ys~EfK~~aV~l~~~~~g~s~~~vA~~lGIs~~tl~~W~k~~~~~~~~~~~   56 (89)
T d2jn6a1           2 PTKTYSEEFKRDAVALYENSDGASLQQIANDLGINRVTLKNWIIKYGSNHNVQGT   56 (89)
T ss_dssp             CCCCCCHHHHHHHHHHHTTGGGSCHHHHHHHHTSCHHHHHHHHHHHCCCSTTCSC
T ss_pred             cCCCCCHHHHHHHHHHHHHcCCCcHHHHHHHHCCCHHHHHHHHHHHhhcccccCC
Confidence            4678999999999999986 47899999999999999999999999877654443



>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2coba1 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LCoR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coba1 a.4.1.15 (A:8-70) Ligand-dependent corepressor (LCoR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1g2ha_ a.4.1.12 (A:) Transcriptional regulator TyrR, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1ntca_ a.4.1.12 (A:) DNA-binding domain of NTRC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2ha_ a.4.1.12 (A:) Transcriptional regulator TyrR, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q06a_ a.6.1.3 (A:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r8da_ a.6.1.3 (A:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q06a_ a.6.1.3 (A:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r8da_ a.6.1.3 (A:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r8ea1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8ea1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ezla_ a.4.1.2 (A:) Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase {Bacteriophage mu [TaxId: 10677]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ao9a1 a.4.1.17 (A:13-132) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2ezla_ a.4.1.2 (A:) Ibeta subdomain of the mu end DNA-binding domain of phage mu transposase {Bacteriophage mu [TaxId: 10677]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ntca_ a.4.1.12 (A:) DNA-binding domain of NTRC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g7la1 a.4.1.9 (A:16-83) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g7ga1 a.4.1.9 (A:9-73) Putative transcriptional regulator Rha04620 {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d2np5a1 a.4.1.9 (A:9-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i10a1 a.4.1.9 (A:10-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fbqa1 a.4.1.9 (A:2-80) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1t56a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2gfna1 a.4.1.9 (A:4-80) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jt6a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iu5a1 a.4.1.9 (A:1-71) Transcriptional activator DhaS {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zk8a1 a.4.1.9 (A:6-77) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fq4a1 a.4.1.9 (A:9-77) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nera_ a.35.1.2 (A:) Ner {Bacteriophage mu [TaxId: 10677]} Back     information, alignment and structure
>d1v7ba1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2vkva1 a.4.1.9 (A:6-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pb6a1 a.4.1.9 (A:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hkua1 a.4.1.9 (A:18-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ui5a1 a.4.1.9 (A:5-75) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3c07a1 a.4.1.9 (A:15-89) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2o7ta1 a.4.1.9 (A:1-78) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d2i10a1 a.4.1.9 (A:10-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d6ya1 a.4.1.9 (A:7-74) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1sgma1 a.4.1.9 (A:5-77) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2fx0a1 a.4.1.9 (A:4-76) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2esna1 a.4.5.37 (A:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t56a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2id3a1 a.4.1.9 (A:13-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bl0a2 a.4.1.8 (A:63-124) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pb6a1 a.4.1.9 (A:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jt6a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d3c07a1 a.4.1.9 (A:15-89) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2g3ba1 a.4.1.9 (A:2-73) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2ao9a1 a.4.1.17 (A:13-132) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2g7ga1 a.4.1.9 (A:9-73) Putative transcriptional regulator Rha04620 {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d2o7ta1 a.4.1.9 (A:1-78) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} Back     information, alignment and structure
>d2hkua1 a.4.1.9 (A:18-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1vi0a1 a.4.1.9 (A:6-77) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d2gfna1 a.4.1.9 (A:4-80) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d1v7ba1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2id6a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2oi8a1 a.4.1.9 (A:8-86) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ixca1 a.4.5.37 (A:1-89) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j9ia_ a.6.1.5 (A:) Terminase gpNU1 subunit domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2fd5a1 a.4.1.9 (A:1-76) Probable transcriptional regulator PA3133 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2vkva1 a.4.1.9 (A:6-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d6ya1 a.4.1.9 (A:7-74) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2fq4a1 a.4.1.9 (A:9-77) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1rr7a_ a.4.1.14 (A:) Middle operon regulator, Mor {Bacteriophage Mu [TaxId: 10677]} Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fx0a1 a.4.1.9 (A:4-76) Hemolysin II regulatory protein, HlyIIR {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbqa1 a.4.1.9 (A:2-80) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1r71a_ a.4.14.1 (A:) Transcriptional repressor protein KorB DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2np5a1 a.4.1.9 (A:9-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1vi0a1 a.4.1.9 (A:6-77) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} Back     information, alignment and structure
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ui5a1 a.4.1.9 (A:5-75) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1bl0a2 a.4.1.8 (A:63-124) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ba1 a.4.1.9 (A:2-73) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]} Back     information, alignment and structure
>d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rkta1 a.4.1.9 (A:2-82) Hypothetical transcriptional regulator YfiR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sgma1 a.4.1.9 (A:5-77) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2id6a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ic8a2 a.35.1.1 (A:87-180) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rr7a_ a.4.1.14 (A:) Middle operon regulator, Mor {Bacteriophage Mu [TaxId: 10677]} Back     information, alignment and structure
>d2id3a1 a.4.1.9 (A:13-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure