Diaphorina citri psyllid: psy17322

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----

KKTIPPLTRDLNARAESEACRILFRLPAICLFLSPSKKTIPPLTRDLNARAESEACRILFRLPATEKLDGSIAAQLYTPYNRSQVNGRMFISQNYICFDSKIENLVSVVIPLRDVQTIYQVDKDMESKSVEIVLHPKQYFGCDATTTYVFIVEKDAKRLREKKLSQSSISSSTSSETAEQIQGPLLNLFKPDVGIETRSKEEVKNKQWELHFNRYKRGVSMYRTAEMTNLILRGVPDAKRREIWLTCSGALNEMLRDPDLYAAMRRRVQNERPNSNLSLSCDEIERDLHRSLPEHPAFQCEIGINALRRVLTAYAAKNPQIGYCQAMNIVTSVFLIYTSEQEAFWLLVCLCESLLPDYYNTKVVGALVDQGVMNDLIEEYLPNLHEKLQNMGMIRMISLSWFLTIFLSLDVKST

ccccccccccccccccHHHHHHHHHcHHHHccccccccccccccccHHHHHHcHHHHHHccccccccccCEEEEEEEcccccccccCEEEccccEEEEEEcccccEEEEEEcccEEEEcccccccccccEEEEEccHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccHHHHHHHHHHccHHHHHcccHHHHHHHHHHccccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHcccccccc

******LTRDLNARAESEACRILFRLPAICLFLSPSKKTIPPLTRDLNARAESEACRILFRLPATEKLDGSIAAQLYTPYNRSQVNGRMFISQNYICFDSKIENLVSVVIPLRDVQTIYQVDKDMESKSVEIVLHPKQYFGCDATTTYVFIVEK*******************************LNLFKPDVGI********KNKQWELHFNRYKRGVSMYRTAEMTNLILRGVPDAKRREIWLTCSGALNEMLRDPDLYAAMRRRVQ*********LSCDEIERDLHRSLPEHPAFQCEIGINALRRVLTAYAAKNPQIGYCQAMNIVTSVFLIYTSEQEAFWLLVCLCESLLPDYYNTKVVGALVDQGVMNDLIEEYLPNLHEKLQNMGMIRMISLSWFLTIFLSLDVKS*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0009894 [BP]	regulation of catabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0051345 [BP]	positive regulation of hydrolase activity	probable	GO:0051336, GO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048518 [BP]	positive regulation of biological process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0080090 [BP]	regulation of primary metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0031323 [BP]	regulation of cellular metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QYE, chain A
Confidence level:very confident
Coverage over the Query: 201-413
View the alignment between query and template
View the model in PyMOL

Template: 1ZSQ, chain A
Confidence level:probable
Coverage over the Query: 60-165
View the alignment between query and template
View the model in PyMOL