Diaphorina citri psyllid: psy17326


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MDESSRSTIISTKIYWPNGLTLDIATRRVYFAESKLDFIDFCNYDGTSRQQDTLYWTDRQLNRVVAGSHYLLHPHSLTIFEDTLYWTDRQLNRVLSAHKFRGKNQTVVSHLISQPLSIHVHHPSLQPITRNDCVNAPCQQLCLLSPSSSTGYTCKCIAGFRVTKDGRCVEEETPVLLVMKGSQIVDVSLKPGDKKETPVLLVMKGSQIVDVSLKPGDKSSGIITPVVGVENGLQVEFDKKAAMLYWLEGTKKANEEDGGNENDN
ccccccEEEEEcccccccEEEEEccccEEEEEEcccccEEEEEcccccCEEEccccccccccEEEEccccccccEEEEEEccEEEEEEccccEEEEEcccccccEEEEcccccccCEEEEEccccccccccccccccccccEEEcccccccEEEEccccCEEcccccCCcccccEEEEEEccCEEEccccccccccccCEEEEccccEEEEEcccccccccEEEEccccccEEEEEEEccccEEEEEEccccEEEEcccccccc
****SRSTIISTKIYWPNGLTLDIATRRVYFAESKLDFIDFCNYDGTSRQQDTLYWTDRQLNRVVAGSHYLLHPHSLTIFEDTLYWTDRQLNRVLSAHKFRGKNQTVVSHLISQPLSIHVHHPSLQPITRNDCVNAPCQQLCLLSPSSSTGYTCKCIAGFRVTKDGRCVEEETPVLLVMKGSQIVDVSLKPGDKKETPVLLVMKGSQIVDVSLKPGDKSSGIITPVVGVENGLQVEFDKKAAMLYWLEGTKKAN**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDESSRSTIISTKIYWPNGLTLDIATRRVYFAESKLDFIDFCNYDGTSRQQDTLYWTDRQLNRVVAGSHYLLHPHSLTIFEDTLYWTDRQLNRVLSAHKFRGKNQTVVSHLISQPLSIHVHHPSLQPITRNDCVNAPCQQLCLLSPSSSTGYTCKCIAGFRVTKDGRCVEEETPVLLVMKGSQIVDVSLKPGDKKETPVLLVMKGSQIVDVSLKPGDKSSGIITPVVGVENGLQVEFDKKAAMLYWLEGTKKANEEDGGNENDN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030111 [BP]regulation of Wnt receptor signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S94, chain A
Confidence level:very confident
Coverage over the Query: 1-50,74-189,214-260
View the alignment between query and template
View the model in PyMOL