Psyllid ID: psy17326
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 264 | ||||||
| 270015974 | 2145 | hypothetical protein TcasGA2_TC004414 [T | 0.829 | 0.102 | 0.647 | 9e-92 | |
| 242019639 | 4568 | low-density lipoprotein receptor, putati | 0.833 | 0.048 | 0.626 | 5e-88 | |
| 328709384 | 4640 | PREDICTED: low-density lipoprotein recep | 0.829 | 0.047 | 0.638 | 2e-87 | |
| 307171853 | 4578 | Low-density lipoprotein receptor-related | 0.837 | 0.048 | 0.612 | 4e-85 | |
| 307208125 | 4539 | Low-density lipoprotein receptor-related | 0.837 | 0.048 | 0.600 | 4e-83 | |
| 383859306 | 4572 | PREDICTED: low-density lipoprotein recep | 0.837 | 0.048 | 0.612 | 2e-82 | |
| 195049411 | 4576 | GH24913 [Drosophila grimshawi] gi|193893 | 0.829 | 0.047 | 0.588 | 3e-82 | |
| 350411403 | 4608 | PREDICTED: low-density lipoprotein recep | 0.837 | 0.047 | 0.600 | 4e-82 | |
| 194890512 | 4502 | GG18978 [Drosophila erecta] gi|190648976 | 0.829 | 0.048 | 0.584 | 5e-82 | |
| 195132161 | 4555 | GI15973 [Drosophila mojavensis] gi|19390 | 0.829 | 0.048 | 0.588 | 5e-82 |
| >gi|270015974|gb|EFA12422.1| hypothetical protein TcasGA2_TC004414 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 342 bits (877), Expect = 9e-92, Method: Compositional matrix adjust.
Identities = 165/255 (64%), Positives = 193/255 (75%), Gaps = 36/255 (14%)
Query: 1 MDESSRSTIISTKIYWPNGLTLDIATRRVYFAESKLDFIDFCNYDGTSRQQDTLYWTDRQ 60
MD + RSTII+TKIYWPNGLTLD AT+RVYFA+SKLDFIDFC Y+GT RQQ
Sbjct: 1537 MDGTKRSTIINTKIYWPNGLTLDTATQRVYFADSKLDFIDFCYYNGTGRQQ--------- 1587
Query: 61 LNRVVAGSHYLLHPHSLTIFEDTLYWTDRQLNRVLSAHKFRGKNQTVVSHLISQPLSIHV 120
V+AGSHYLLHPHSLT+FEDTLYWTDRQLNRVLSAHKF+G NQTVVSHLISQPLSIHV
Sbjct: 1588 ---VLAGSHYLLHPHSLTLFEDTLYWTDRQLNRVLSAHKFKGNNQTVVSHLISQPLSIHV 1644
Query: 121 HHPSLQPITRNDCVNAPCQQLCLLSPSSSTGYTCKCIAGFRVTKDGRCVEEETPVLLVMK 180
HHPSLQPIT N C N PCQ +CLLSPSSSTGYTCKC AGF++ DGRC EEE +LLVM
Sbjct: 1645 HHPSLQPITENPCQNNPCQHICLLSPSSSTGYTCKCKAGFKLISDGRCTEEELSLLLVMT 1704
Query: 181 GSQIVDVSLKPGDKKETPVLLVMKGSQIVDVSLKPGDKSSGIITPVVGVENGLQVEFDKK 240
G+QI+DVS P GD S+G +TP+VGVENG+Q+E+D+K
Sbjct: 1705 GTQIIDVSATP------------------------GDNSAGFLTPIVGVENGVQIEYDRK 1740
Query: 241 AAMLYWLEGTKKANE 255
++++W+EG + +E
Sbjct: 1741 NSVVFWVEGKETEDE 1755
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242019639|ref|XP_002430267.1| low-density lipoprotein receptor, putative [Pediculus humanus corporis] gi|212515374|gb|EEB17529.1| low-density lipoprotein receptor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|328709384|ref|XP_001944217.2| PREDICTED: low-density lipoprotein receptor-related protein 2-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307171853|gb|EFN63508.1| Low-density lipoprotein receptor-related protein 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307208125|gb|EFN85629.1| Low-density lipoprotein receptor-related protein 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383859306|ref|XP_003705136.1| PREDICTED: low-density lipoprotein receptor-related protein 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|195049411|ref|XP_001992716.1| GH24913 [Drosophila grimshawi] gi|193893557|gb|EDV92423.1| GH24913 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|350411403|ref|XP_003489337.1| PREDICTED: low-density lipoprotein receptor-related protein 2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|194890512|ref|XP_001977327.1| GG18978 [Drosophila erecta] gi|190648976|gb|EDV46254.1| GG18978 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195132161|ref|XP_002010512.1| GI15973 [Drosophila mojavensis] gi|193908962|gb|EDW07829.1| GI15973 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 264 | ||||||
| FB|FBgn0261260 | 4769 | mgl "Megalin" [Drosophila mela | 0.693 | 0.038 | 0.651 | 2.9e-64 | |
| ZFIN|ZDB-GENE-050119-2 | 4673 | lrp2a "low density lipoprotein | 0.738 | 0.041 | 0.386 | 9.2e-35 | |
| RGD|68407 | 4660 | Lrp2 "low density lipoprotein | 0.734 | 0.041 | 0.375 | 2.4e-34 | |
| UNIPROTKB|P98158 | 4660 | Lrp2 "Low-density lipoprotein | 0.734 | 0.041 | 0.375 | 2.4e-34 | |
| UNIPROTKB|F1N6H1 | 4626 | LRP2 "Uncharacterized protein" | 0.746 | 0.042 | 0.377 | 3e-34 | |
| UNIPROTKB|F1PIB4 | 4549 | LRP2 "Uncharacterized protein" | 0.742 | 0.043 | 0.353 | 4.8e-34 | |
| MGI|MGI:95794 | 4660 | Lrp2 "low density lipoprotein | 0.734 | 0.041 | 0.365 | 6.3e-34 | |
| UNIPROTKB|F1NJS9 | 4644 | LRP2 "Uncharacterized protein" | 0.776 | 0.044 | 0.381 | 7e-34 | |
| UNIPROTKB|F1NCT2 | 4645 | LRP2 "Uncharacterized protein" | 0.776 | 0.044 | 0.381 | 7e-34 | |
| WB|WBGene00003071 | 4753 | lrp-1 [Caenorhabditis elegans | 0.719 | 0.039 | 0.375 | 7.5e-33 |
| FB|FBgn0261260 mgl "Megalin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 659 (237.0 bits), Expect = 2.9e-64, Sum P(2) = 2.9e-64
Identities = 127/195 (65%), Positives = 148/195 (75%)
Query: 1 MDESSRSTIISTKIYWPNGLTLDIATRRVYFAESKLDFIDFCNYDGTSRQQDTLYWTDRQ 60
MD + R TII+TKIYWPNGLTLDIAT+RVYFA+SKLDFIDFC Y+GT RQQ
Sbjct: 1706 MDGTMRKTIINTKIYWPNGLTLDIATKRVYFADSKLDFIDFCYYNGTGRQQ--------- 1756
Query: 61 LNRVVAGSHYLLHPHSLTIFEDTLYWTDRQLNRVLSAHKFRGKNQTVVSHLISQPLSIHV 120
V+A SHYLLHPHSL++FEDTLYWTDRQLNRVLSA+KFRGKNQTVVSHLISQPLSIHV
Sbjct: 1757 ---VLASSHYLLHPHSLSLFEDTLYWTDRQLNRVLSANKFRGKNQTVVSHLISQPLSIHV 1813
Query: 121 HHPSLQPITRNDCVNAXXXXXXXXXXXXXTGYTCKCIAGFRVTKDGRCVEEETPVLLVMK 180
HH SLQP+T N C + GY+CKC GF++ +GRC+EEE P L+V+K
Sbjct: 1814 HHASLQPMTPNPCAGSRCQHLCLLSPSAPEGYSCKCRPGFKLLSEGRCIEEENPFLMVVK 1873
Query: 181 GSQIVDVSLKPGDKK 195
G+QIVD+ L GD +
Sbjct: 1874 GTQIVDLPLNGGDAR 1888
|
|
| ZFIN|ZDB-GENE-050119-2 lrp2a "low density lipoprotein receptor-related protein 2a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|68407 Lrp2 "low density lipoprotein receptor-related protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P98158 Lrp2 "Low-density lipoprotein receptor-related protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N6H1 LRP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PIB4 LRP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:95794 Lrp2 "low density lipoprotein receptor-related protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NJS9 LRP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NCT2 LRP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003071 lrp-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 264 | |||
| smart00135 | 43 | smart00135, LY, Low-density lipoprotein-receptor Y | 5e-10 |
| >gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
Score = 53.4 bits (129), Expect = 5e-10
Identities = 17/42 (40%), Positives = 27/42 (64%)
Query: 8 TIISTKIYWPNGLTLDIATRRVYFAESKLDFIDFCNYDGTSR 49
T++S+ + PNGL +D R+Y+ + LD I+ N DGT+R
Sbjct: 2 TLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
|
Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin. Length = 43 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| KOG1214|consensus | 1289 | 99.96 | ||
| KOG1215|consensus | 877 | 99.92 | ||
| KOG1215|consensus | 877 | 99.82 | ||
| KOG1214|consensus | 1289 | 99.38 | ||
| PF00058 | 42 | Ldl_recept_b: Low-density lipoprotein receptor rep | 99.06 | |
| smart00135 | 43 | LY Low-density lipoprotein-receptor YWTD domain. T | 99.02 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 98.88 | |
| PF00058 | 42 | Ldl_recept_b: Low-density lipoprotein receptor rep | 98.33 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 98.23 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 98.16 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 97.8 | |
| smart00135 | 43 | LY Low-density lipoprotein-receptor YWTD domain. T | 97.74 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 97.46 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 97.35 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 97.24 | |
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 96.95 | |
| KOG4499|consensus | 310 | 96.63 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 96.59 | |
| PF09064 | 34 | Tme5_EGF_like: Thrombomodulin like fifth domain, E | 96.4 | |
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 96.11 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 96.09 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 95.8 | |
| KOG1520|consensus | 376 | 95.59 | ||
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 95.58 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 95.58 | |
| KOG4659|consensus | 1899 | 95.43 | ||
| TIGR03032 | 335 | conserved hypothetical protein TIGR03032. This pro | 95.0 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 94.87 | |
| PF01731 | 86 | Arylesterase: Arylesterase; InterPro: IPR002640 Th | 94.86 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 94.79 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 94.43 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 94.16 | |
| PF03022 | 287 | MRJP: Major royal jelly protein; InterPro: IPR0035 | 93.22 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 93.06 | |
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 92.65 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 92.39 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 91.65 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 91.55 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 91.47 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 91.36 | |
| KOG4659|consensus | 1899 | 90.37 | ||
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 88.39 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 86.0 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 85.4 | |
| KOG1520|consensus | 376 | 85.06 | ||
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 84.92 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 84.78 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 83.92 | |
| KOG1219|consensus | 4289 | 82.88 | ||
| TIGR03032 | 335 | conserved hypothetical protein TIGR03032. This pro | 81.51 | |
| KOG1219|consensus | 4289 | 81.14 |
| >KOG1214|consensus | Back alignment and domain information |
|---|
Probab=99.96 E-value=2.6e-29 Score=239.86 Aligned_cols=156 Identities=31% Similarity=0.576 Sum_probs=133.7
Q ss_pred CCCCCcEEEEeCCCCCccEEEEeCCCCeEEEEeCCCCeEEEEecCCCceeE------------------eEEEeeccc--
Q psy17326 1 MDESSRSTIISTKIYWPNGLTLDIATRRVYFAESKLDFIDFCNYDGTSRQQ------------------DTLYWTDRQ-- 60 (264)
Q Consensus 1 mDGs~r~~iv~~~l~~P~gLaiD~~~~rLYW~D~~~~~Ie~~~ldG~~r~~------------------~~lfwtd~~-- 60 (264)
|.|.+.++||.++|..|.|||||+..+.+||+|+.+++||++.|||+.|++ |+||||||+
T Consensus 1054 L~G~Ep~ti~n~~L~SPEGiAVDh~~Rn~ywtDS~lD~IevA~LdG~~rkvLf~tdLVNPR~iv~D~~rgnLYwtDWnRe 1133 (1289)
T KOG1214|consen 1054 LEGAEPETIVNSGLISPEGIAVDHIRRNMYWTDSVLDKIEVALLDGSERKVLFYTDLVNPRAIVVDPIRGNLYWTDWNRE 1133 (1289)
T ss_pred ccCCCCceeecccCCCccceeeeeccceeeeeccccchhheeecCCceeeEEEeecccCcceEEeecccCceeecccccc
Confidence 568999999999999999999999999999999999999999999999987 899999995
Q ss_pred ---c---------ee-------------------------------------------EEeCCcccccceeeeeeCCEEE
Q psy17326 61 ---L---------NR-------------------------------------------VVAGSHYLLHPHSLTIFEDTLY 85 (264)
Q Consensus 61 ---~---------~~-------------------------------------------vl~~~~~l~~P~~l~v~~d~lY 85 (264)
| +| ++.+ .|.+||+|+-+++.+|
T Consensus 1134 nPkIets~mDG~NrRilin~DigLPNGLtfdpfs~~LCWvDAGt~rleC~~p~g~gRR~i~~--~LqYPF~itsy~~~fY 1211 (1289)
T KOG1214|consen 1134 NPKIETSSMDGENRRILINTDIGLPNGLTFDPFSKLLCWVDAGTKRLECTLPDGTGRRVIQN--NLQYPFSITSYADHFY 1211 (1289)
T ss_pred CCcceeeccCCccceEEeecccCCCCCceeCcccceeeEEecCCcceeEecCCCCcchhhhh--cccCceeeeeccccce
Confidence 1 11 2222 4789999999999999
Q ss_pred EEcCCCCeEEEEEccCCceeE-EEeccCCCceeEEEecccCCCccccccc--cCCcccceecCCCCCCCeeeecCCCeEE
Q psy17326 86 WTDRQLNRVLSAHKFRGKNQT-VVSHLISQPLSIHVHHPSLQPITRNDCV--NAPCQQLCLLSPSSSTGYTCKCIAGFRV 162 (264)
Q Consensus 86 wtD~~~~~i~~~~k~~g~~~~-~i~~~~~~p~~i~v~~~~~qp~~~npC~--~~~CshlCl~~p~~~~~~~C~Cp~G~~L 162 (264)
||||+.++|.+++|+.++... .+.....+.|||..+- ...|.+++||+ |+||.||||+. .++..|.||+..+.
T Consensus 1212 ~TDWk~n~vvsv~~~~~~~td~~~p~~~s~lyGItav~-~~Cp~gstpCSedNGGCqHLCLpg---qngavcecpdnvkv 1287 (1289)
T KOG1214|consen 1212 HTDWKRNGVVSVNKHSGQFTDEYLPEQRSHLYGITAVY-PYCPTGSTPCSEDNGGCQHLCLPG---QNGAVCECPDNVKV 1287 (1289)
T ss_pred eeccccCceEEeeccccccccccccccccceEEEEecc-ccCCCCCCcccccCCcceeecccC---cCCccccCCcccee
Confidence 999999999999999887653 4556667799998773 45688999998 56999999975 36899999997653
|
|
| >KOG1215|consensus | Back alignment and domain information |
|---|
| >KOG1215|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >smart00135 LY Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >smart00135 LY Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >KOG4499|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1520|consensus | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >KOG4659|consensus | Back alignment and domain information |
|---|
| >TIGR03032 conserved hypothetical protein TIGR03032 | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG4659|consensus | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1520|consensus | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >TIGR03032 conserved hypothetical protein TIGR03032 | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 264 | ||||
| 3s94_A | 619 | Crystal Structure Of Lrp6-E1e2 Length = 619 | 4e-27 | ||
| 4dg6_A | 616 | Crystal Structure Of Domains 1 And 2 Of Lrp6 Length | 4e-27 | ||
| 3v64_C | 349 | Crystal Structure Of Agrin And Lrp4 Length = 349 | 2e-26 | ||
| 3v65_B | 386 | Crystal Structure Of Agrin And Lrp4 Complex Length | 3e-26 | ||
| 3sob_B | 316 | The Structure Of The First Ywtd Beta Propeller Doma | 3e-26 | ||
| 3soq_A | 318 | The Structure Of The First Ywtd Beta Propeller Doma | 4e-25 | ||
| 4a0p_A | 628 | Crystal Structure Of Lrp6p3e3p4e4 Length = 628 | 3e-16 | ||
| 3s2k_A | 629 | Structural Basis Of Wnt Signaling Inhibition By Dic | 3e-16 | ||
| 3s8v_A | 623 | Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 | 3e-16 | ||
| 3p5b_L | 400 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 2e-12 | ||
| 1ijq_A | 316 | Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma | 2e-12 | ||
| 3p5c_L | 440 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 2e-12 | ||
| 3m0c_C | 791 | The X-Ray Crystal Structure Of Pcsk9 In Complex Wit | 2e-12 | ||
| 1n7d_A | 699 | Extracellular Domain Of The Ldl Receptor Length = 6 | 3e-12 |
| >pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 | Back alignment and structure |
|
| >pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 | Back alignment and structure |
| >pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 | Back alignment and structure |
| >pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 | Back alignment and structure |
| >pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 | Back alignment and structure |
| >pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 | Back alignment and structure |
| >pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 | Back alignment and structure |
| >pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 | Back alignment and structure |
| >pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 | Back alignment and structure |
| >pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 | Back alignment and structure |
| >pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 | Back alignment and structure |
| >pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 | Back alignment and structure |
| >pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 | Back alignment and structure |
| >pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 264 | |||
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 7e-54 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 1e-51 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 5e-50 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 9e-45 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 2e-04 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 3e-43 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 2e-08 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 3e-41 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 3e-10 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 2e-37 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 2e-31 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 9e-30 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 6e-10 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 1e-05 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 1e-30 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 2e-19 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 1e-09 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 8e-30 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 2e-28 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 4e-08 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 6e-08 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-04 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 1e-04 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 2e-04 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 2e-04 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 2e-04 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 4e-04 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 8e-04 |
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
Score = 185 bits (469), Expect = 7e-54
Identities = 52/208 (25%), Positives = 93/208 (44%), Gaps = 20/208 (9%)
Query: 1 MDESSRSTIISTKIYWPNGLTLDIATRRVYFAESKLDFIDFCNYDGTSRQQDTLYWTDRQ 60
++ ++++ I WPNG+TLD+ + R+Y+ +SKL I + +G +R+
Sbjct: 544 LNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKT--------- 594
Query: 61 LNRVVAGSHYLLHPHSLTIFEDTLYWTDRQLNRVLSAHKFRGKNQTVVSHLISQPLSIHV 120
++ L HP SL +FED ++WTD + SA++ G + +++ + P + +
Sbjct: 595 ---ILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVL 651
Query: 121 HHPSLQPITRNDCV-----NAPCQQLCLLSP---SSSTGYTCKCIAGFRVTKDGRCVEEE 172
H QP N C N CQ LCL +P S +TC C G + +D R E
Sbjct: 652 FHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTE 711
Query: 173 TPVLLVMKGSQIVDVSLKPGDKKETPVL 200
+ + + V + + +
Sbjct: 712 AEAAVATQETSTVRLKVSSTAVRTQHTT 739
|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 100.0 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 100.0 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 100.0 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 100.0 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 100.0 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 100.0 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 100.0 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 100.0 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 100.0 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 100.0 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 99.97 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 99.7 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 99.69 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 99.65 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 99.65 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 99.56 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 99.55 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 99.51 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 99.44 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 99.25 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 99.23 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 98.85 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 98.52 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 98.4 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 98.39 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 98.36 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 98.23 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 98.21 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 98.21 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 98.16 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 98.1 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 98.05 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 97.99 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 97.94 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 97.93 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 97.91 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 97.83 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 97.78 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 97.77 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 97.75 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 97.73 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 97.71 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 97.62 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 97.49 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 97.48 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 97.39 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 97.37 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 97.32 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 97.24 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 97.18 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 97.12 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 97.08 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 97.04 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 96.96 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 96.92 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 96.92 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 96.91 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 96.9 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 96.76 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 96.67 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 96.62 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 96.62 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 96.61 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 96.59 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 96.52 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 96.49 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 96.47 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 96.47 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 96.24 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 96.13 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 96.07 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 96.02 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 95.99 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 95.98 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 95.8 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 95.75 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 95.56 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 95.55 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 95.52 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 95.5 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 95.44 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 95.35 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 95.29 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 95.27 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 95.22 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 95.21 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 95.18 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 95.15 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 95.12 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 95.05 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 95.05 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 94.99 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 94.98 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 94.97 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 94.97 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 94.88 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 94.73 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 94.67 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 94.62 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 94.62 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 94.6 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 94.58 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 94.39 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 94.38 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 94.37 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 94.26 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 94.19 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 94.12 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 94.07 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 94.02 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 93.72 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 93.71 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 93.45 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 93.35 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 93.32 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 93.14 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 92.69 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 92.3 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 92.15 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 91.98 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 91.96 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 91.92 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 91.91 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 91.51 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 91.42 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 90.83 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 90.77 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 90.12 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 89.49 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 88.66 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 88.3 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 88.24 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 88.16 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 88.0 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 87.75 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 87.63 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 87.63 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 87.45 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 87.38 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 87.07 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 86.99 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 86.98 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 86.71 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 86.43 | |
| 3q6k_A | 381 | 43.2 kDa salivary protein; beta propeller, binding | 86.21 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 86.11 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 85.02 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 84.91 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 84.85 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 84.44 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 83.65 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 83.47 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 83.25 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 83.2 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 82.51 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 81.12 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 80.98 | |
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 80.98 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 80.93 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 80.87 |
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-44 Score=353.42 Aligned_cols=220 Identities=36% Similarity=0.729 Sum_probs=190.9
Q ss_pred CCCCCcEEEEeCCCCCccEEEEeCCCCeEEEEeCCCCeEEEEecCCCceeEeEEEeecccceeEEeCCcccccceeeeee
Q psy17326 1 MDESSRSTIISTKIYWPNGLTLDIATRRVYFAESKLDFIDFCNYDGTSRQQDTLYWTDRQLNRVVAGSHYLLHPHSLTIF 80 (264)
Q Consensus 1 mDGs~r~~iv~~~l~~P~gLaiD~~~~rLYW~D~~~~~Ie~~~ldG~~r~~~~lfwtd~~~~~vl~~~~~l~~P~~l~v~ 80 (264)
|||+++++|+...+.+|+|||+|+.+++|||+|+..++|+++++||++|++ ++.+ .+.||+||+++
T Consensus 157 ~dG~~~~~l~~~~~~~P~Glald~~~~~LY~aD~~~~~I~~~~~dG~~~~~------------~~~~--~~~~P~gi~~~ 222 (619)
T 3s94_A 157 MDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQA------------VVKG--SLPHPFALTLF 222 (619)
T ss_dssp TTSCSCEEEECSSCSSEEEEEEETTTTEEEEEETTTCCEEEESSSCCEEC-----------------------CCCEEES
T ss_pred CCCCceEEEEeCCCCCCcEEEEEccCCEEEEEeCCCCeEEEecCCCCccEE------------EEeC--CCCCceEEEEe
Confidence 799999999998999999999999999999999999999999999999998 7664 47899999999
Q ss_pred CCEEEEEcCCCCeEEEEEccCCceeEEEeccCCCceeEEEecccCCCccccccc--cCCcccceecCCCCCCCeeeecCC
Q psy17326 81 EDTLYWTDRQLNRVLSAHKFRGKNQTVVSHLISQPLSIHVHHPSLQPITRNDCV--NAPCQQLCLLSPSSSTGYTCKCIA 158 (264)
Q Consensus 81 ~d~lYwtD~~~~~i~~~~k~~g~~~~~i~~~~~~p~~i~v~~~~~qp~~~npC~--~~~CshlCl~~p~~~~~~~C~Cp~ 158 (264)
+++|||+||.+++|.+++|++|+..+++..++..|++|++||+.+||.+.|||. +++|||+|+++|.. .+|+|+||.
T Consensus 223 ~~~ly~td~~~~~V~~~d~~tg~~~~~i~~~~~~p~~i~v~~~~~qp~~~n~C~~~ng~Cs~lCl~~~~~-~~~~C~C~~ 301 (619)
T 3s94_A 223 EDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVK-PFYQCACPT 301 (619)
T ss_dssp SSEEEEECTTTCSEEEEESSSCCCCEECCSCCCCCSEEEECCGGGSCCCCCTTTTTGGGCSSEEEECSST-TSEEEECCT
T ss_pred CCEEEEecCCCCEEEEEECCCCcccEEEecCCCCCcEEEEEccccCCCccccccCCCCcccceEECCCCC-CCceEeCCc
Confidence 999999999999999999999999888888888999999999999999999997 46999999998853 479999999
Q ss_pred CeEEcCC-CCCCCCCccEEEEEeCCeEEEEEcCCCCCCCcceeEeeeCceeEEeeeCCCCCCCceEEEecCCCCcEEEEE
Q psy17326 159 GFRVTKD-GRCVEEETPVLLVMKGSQIVDVSLKPGDKKETPVLLVMKGSQIVDVSLKPGDKSSGIITPVVGVENGLQVEF 237 (264)
Q Consensus 159 G~~L~~~-~tC~~~~~~~ll~~~~~~i~~i~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~id~ 237 (264)
||.|.++ ++|.+.+++||||+++..|++|.+ ++...+ ..++|+.++.++++|||
T Consensus 302 g~~l~~d~~~C~~~~~~~Ll~~~~~~i~~i~l------------------------~~~~~~-~~~~~~~~l~~~~~ld~ 356 (619)
T 3s94_A 302 GVKLLENGKTCKDGATELLLLARRTDLRRISL------------------------DTPDFT-DIVLQLEDIRHAIAIDY 356 (619)
T ss_dssp TCCBCTTSSCBCSSCSEEEEEEESSCEEEEES------------------------SSTTCC-CEECCCSCCSSEEEEEE
T ss_pred hheecccCcccCCCCceEEEEEcccceEEEec------------------------CCCccc-eeEEeccccCccEEEEE
Confidence 9999984 689988889999999999999955 444332 56789999999999999
Q ss_pred ECCCCEEEEEeCC-Ceeec--cCCCC
Q psy17326 238 DKKAAMLYWLEGT-KKANE--EDGGN 260 (264)
Q Consensus 238 D~~~~~iYW~D~~-~~~~~--~~~~~ 260 (264)
|+.+++|||+|.. .+|.| .+|++
T Consensus 357 d~~~~~ly~sD~~~~~I~r~~~~g~~ 382 (619)
T 3s94_A 357 DPVEGYIYWTDDEVRAIRRSFIDGSG 382 (619)
T ss_dssp ETTTTEEEEEETTTTEEEEEETTSCS
T ss_pred EcCCCeEEEEeCCCCeEEEEEcCCCc
Confidence 9999999999964 56776 56654
|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 264 | ||||
| d1ijqa1 | 266 | b.68.5.1 (A:377-642) Low density lipoprotein (LDL) | 1e-24 | |
| d1npea_ | 263 | b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId | 9e-21 | |
| d1szba2 | 45 | g.3.11.1 (A:124-168) Mannose-binding protein assoc | 6e-06 | |
| d1ijqa2 | 50 | g.3.11.1 (A:643-692) Low density lipoprotein (LDL) | 9e-06 | |
| d1autl2 | 50 | g.3.11.1 (L:97-146) Activated protein c (autoproth | 1e-05 | |
| d2bz6l1 | 53 | g.3.11.1 (L:90-142) Coagulation factor VIIa {Human | 1e-05 | |
| d1kigl_ | 51 | g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo | 2e-05 | |
| d2p3ua1 | 51 | g.3.11.1 (A:87-137) Factor X, N-terminal module {H | 2e-05 | |
| d1rfnb_ | 57 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 2e-05 | |
| d1i0ua2 | 41 | g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r | 3e-05 | |
| d1nzia2 | 42 | g.3.11.1 (A:118-159) Complement C1S component {Hum | 5e-05 | |
| d3bpse1 | 40 | g.3.11.1 (E:293-332) Low density lipoprotein (LDL) | 1e-04 | |
| d1nt0a3 | 45 | g.3.11.1 (A:120-164) Mannose-binding protein assoc | 4e-04 | |
| d1apqa_ | 53 | g.3.11.1 (A:) Complement protease C1R {Human (Homo | 0.001 | |
| d1uzka1 | 43 | g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa | 0.002 | |
| d1dx5i1 | 43 | g.3.11.1 (I:345-387) Thrombomodulin, different EGF | 0.002 |
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: YWTD domain family: YWTD domain domain: Low density lipoprotein (LDL) receptor species: Human (Homo sapiens) [TaxId: 9606]
Score = 97.3 bits (241), Expect = 1e-24
Identities = 34/127 (26%), Positives = 65/127 (51%), Gaps = 12/127 (9%)
Query: 1 MDESSRSTIISTKIYWPNGLTLDIATRRVYFAESKLDFIDFCNYDGTSRQQDTLYWTDRQ 60
++ ++++ I WPNG+TLD+ + R+Y+ +SKL I + +G +R+
Sbjct: 150 LNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKT--------- 200
Query: 61 LNRVVAGSHYLLHPHSLTIFEDTLYWTDRQLNRVLSAHKFRGKNQTVVSHLISQPLSIHV 120
++ L HP SL +FED ++WTD + SA++ G + +++ + P + +
Sbjct: 201 ---ILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVL 257
Query: 121 HHPSLQP 127
H QP
Sbjct: 258 FHNLTQP 264
|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 99.93 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 99.89 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 99.77 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 99.72 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 99.04 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 98.98 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 98.8 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 98.75 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.75 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 98.72 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 98.69 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 98.68 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.68 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 98.66 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 98.59 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 98.47 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 98.41 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 98.22 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.21 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 98.12 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.87 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.87 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 97.79 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 97.77 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.63 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 97.62 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 97.58 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.55 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 97.51 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 97.51 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 97.29 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 96.77 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 96.71 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 96.65 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.65 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.63 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.61 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 96.46 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 96.39 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 96.37 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 96.26 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 96.23 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.04 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 95.78 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 95.78 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 95.73 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 95.47 | |
| d1dx5i2 | 35 | Thrombomodulin, different EGF-like domains {Human | 95.35 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 95.34 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 95.27 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 95.08 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 94.77 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 94.26 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 94.08 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 93.14 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 93.09 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 91.93 | |
| d1v04a_ | 340 | Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory | 91.51 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 91.02 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 90.97 | |
| d1v04a_ | 340 | Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory | 88.99 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 85.0 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 84.78 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 84.6 |
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: YWTD domain family: YWTD domain domain: Low density lipoprotein (LDL) receptor species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=2.3e-25 Score=193.49 Aligned_cols=117 Identities=29% Similarity=0.607 Sum_probs=110.4
Q ss_pred CCCCCcEEEEeCCCCCccEEEEeCCCCeEEEEeCCCCeEEEEecCCCceeEeEEEeecccceeEEeCCcccccceeeeee
Q psy17326 1 MDESSRSTIISTKIYWPNGLTLDIATRRVYFAESKLDFIDFCNYDGTSRQQDTLYWTDRQLNRVVAGSHYLLHPHSLTIF 80 (264)
Q Consensus 1 mDGs~r~~iv~~~l~~P~gLaiD~~~~rLYW~D~~~~~Ie~~~ldG~~r~~~~lfwtd~~~~~vl~~~~~l~~P~~l~v~ 80 (264)
|||+++++|+..++.+|+|||+|+.+++|||+|...+.|+++++||+++++ ++.....+.+|++|+++
T Consensus 150 ~dGs~~~~l~~~~~~~p~gl~iD~~~~~lYw~d~~~~~I~~~~~dG~~~~~------------~~~~~~~~~~p~~lav~ 217 (266)
T d1ijqa1 150 LNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKT------------ILEDEKRLAHPFSLAVF 217 (266)
T ss_dssp TTSCCEEEEECSSCSCEEEEEEETTTTEEEEEETTTTEEEEEETTSCSCEE------------EEECTTTTSSEEEEEEE
T ss_pred cCCCceecccccccceeeEEEeeccccEEEEecCCcCEEEEEECCCCCEEE------------EEeCCCcccccEEEEEE
Confidence 899999999998999999999999999999999999999999999999988 77765567899999999
Q ss_pred CCEEEEEcCCCCeEEEEEccCCceeEEEeccCCCceeEEEecccCCCcc
Q psy17326 81 EDTLYWTDRQLNRVLSAHKFRGKNQTVVSHLISQPLSIHVHHPSLQPIT 129 (264)
Q Consensus 81 ~d~lYwtD~~~~~i~~~~k~~g~~~~~i~~~~~~p~~i~v~~~~~qp~~ 129 (264)
+++|||+||..++|++++|.+|++.+.+..+...|++|+|||+.+||.+
T Consensus 218 ~~~ly~td~~~~~I~~~~~~~g~~~~~~~~~~~~p~~i~v~~~~~QP~g 266 (266)
T d1ijqa1 218 EDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRG 266 (266)
T ss_dssp TTEEEEEETTTTEEEEEETTTCCCCEEEECSCSCCCCEEEESGGGSCCC
T ss_pred CCEEEEEECCCCeEEEEECCCCcceEEEEcCCCCceEEEEECCccCCCC
Confidence 9999999999999999999999999999888999999999999999954
|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1dx5i2 g.3.11.1 (I:388-422) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|