Diaphorina citri psyllid: psy17330


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MFLAAGPDSSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS
ccccccccccEEEcccccccccEEEEccccccccccEEEEEccccccccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEEECcHHHHHHHHccccccccccEEEEccccccccccccccccEEEEEEccEEEEEEEEEcccccccccccEEEEEccccHHHHHHHHc
********SSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLAAGPDSSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019538 [BP]protein metabolic processprobableGO:0071704, GO:0044238, GO:0008150, GO:0008152, GO:0043170
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0008236 [MF]serine-type peptidase activityprobableGO:0016787, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TVJ, chain B
Confidence level:very confident
Coverage over the Query: 7-33,48-184
View the alignment between query and template
View the model in PyMOL