Diaphorina citri psyllid: psy17330

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----

MFLAAGPDSSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS

ccccccccccEEEcccccccccEEEEccccccccccEEEEEccccccccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEEECcHHHHHHHHccccccccccEEEEccccccccccccccccEEEEEEccEEEEEEEEEcccccccccccEEEEEccccHHHHHHHHc

********SSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNI*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFLAAGPDSSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0019538 [BP]	protein metabolic process	probable	GO:0071704, GO:0044238, GO:0008150, GO:0008152, GO:0043170
GO:0044424 [CC]	intracellular part	probable	GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0008236 [MF]	serine-type peptidase activity	probable	GO:0016787, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233
GO:0065007 [BP]	biological regulation	probable	GO:0008150
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TVJ, chain B
Confidence level:very confident
Coverage over the Query: 7-33,48-184
View the alignment between query and template
View the model in PyMOL