Psyllid ID: psy17330


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MFLAAGPDSSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS
ccccccccccEEEcccccccccEEEEccccccccccEEEEEccccccccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEEEEcHHHHHHHHccccccccccEEEEccccccccccccccccEEEEEEccEEEEEEEEEcccccccccccEEEEEccccHHHHHHHHc
cccccccccEEEEEccccccccEEEEEEccccccccEEEEEEcccccccccEccEEcccccccccccccccEEEEEEccccccccccccHHEEEEEEEccHHHHHHHHHHcHHHccccEEEEEccccccEccccccccEEEEEEccEEEEEEEEEEcccccEccEcEEEEEHHHcHHHHHHHHH
mflaagpdsslhvipsisddshYQILHLEQrkkskackpsqlggvarlpgpagpgcslpwgefrldlssgglrgpgclgsvpgggplspklrhvqisvvdnpkcrqiFSNYGATINENILCAGvlsggkdscggdsggplmypldtkyYIIGVVSYGkkcaevgfpgvytRVTNYIQWIADNIS
MFLAAGPDSSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS
MFLAAGPDSSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRgpgclgsvpgggplspKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLsggkdscggdsggPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS
************************I****************************PGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIAD***
********SSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNI*
*********SLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS
******PDSSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLAAGPDSSLHVIPSISDDSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
P21902375 Proclotting enzyme OS=Tac N/A N/A 0.668 0.328 0.441 5e-24
Q27081400 Clotting factor B OS=Tach N/A N/A 0.554 0.255 0.495 5e-22
P35047256 Trypsin, alkaline C OS=Ma N/A N/A 0.543 0.390 0.457 5e-21
Q7M4I3243 Venom protease OS=Megabom N/A N/A 0.510 0.386 0.510 2e-20
P35045256 Trypsin, alkaline A OS=Ma N/A N/A 0.543 0.390 0.428 2e-19
P35046256 Trypsin, alkaline B OS=Ma N/A N/A 0.543 0.390 0.428 4e-19
P39675261 Mite allergen Der p 3 OS= N/A N/A 0.521 0.367 0.454 2e-18
Q8BZ10417 Transmembrane protease se yes N/A 0.570 0.251 0.411 3e-18
P49275259 Mite allergen Der f 3 OS= N/A N/A 0.516 0.366 0.489 3e-18
Q5QSK2417 Transmembrane protease se yes N/A 0.543 0.239 0.421 4e-18
>sp|P21902|PCE_TACTR Proclotting enzyme OS=Tachypleus tridentatus PE=1 SV=1 Back     alignment and function desciption
 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 81/129 (62%), Gaps = 6/129 (4%)

Query: 58  LPWGEFRLDLSSGGLRGPGCLG--SVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATI 115
           LP+ + R D     +R P   G  +    GP S  LR VQ+ + ++  CRQ +      I
Sbjct: 249 LPYRKLRYD--DLAMRKPFITGWGTTAFNGPSSAVLREVQLPIWEHEACRQAYEK-DLNI 305

Query: 116 NENILCAGVLSGGKDSCGGDSGGPLMYPLDT-KYYIIGVVSYGKKCAEVGFPGVYTRVTN 174
               +CAG   GGKD+C GDSGGP+M P+ T ++Y+IG+VS+GKKCA  GFPGVYT+VT 
Sbjct: 306 TNVYMCAGFADGGKDACQGDSGGPMMLPVKTGEFYLIGIVSFGKKCALPGFPGVYTKVTE 365

Query: 175 YIQWIADNI 183
           ++ WIA+++
Sbjct: 366 FLDWIAEHM 374




This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system in limulus. Its active form catalyzes the conversion of coagulogen to insoluble coagulin gel.
Tachypleus tridentatus (taxid: 6853)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 8EC: 6
>sp|Q27081|CFB_TACTR Clotting factor B OS=Tachypleus tridentatus PE=1 SV=1 Back     alignment and function description
>sp|P35047|TRYC_MANSE Trypsin, alkaline C OS=Manduca sexta PE=2 SV=1 Back     alignment and function description
>sp|Q7M4I3|SP4_MEGPE Venom protease OS=Megabombus pennsylvanicus PE=1 SV=1 Back     alignment and function description
>sp|P35045|TRYA_MANSE Trypsin, alkaline A OS=Manduca sexta PE=2 SV=1 Back     alignment and function description
>sp|P35046|TRYB_MANSE Trypsin, alkaline B OS=Manduca sexta PE=2 SV=1 Back     alignment and function description
>sp|P39675|DERP3_DERPT Mite allergen Der p 3 OS=Dermatophagoides pteronyssinus GN=DERP3 PE=1 SV=1 Back     alignment and function description
>sp|Q8BZ10|TM11G_MOUSE Transmembrane protease serine 11G OS=Mus musculus GN=Tmprss11g PE=2 SV=2 Back     alignment and function description
>sp|P49275|DERF3_DERFA Mite allergen Der f 3 OS=Dermatophagoides farinae GN=DERF3 PE=1 SV=2 Back     alignment and function description
>sp|Q5QSK2|TM11G_RAT Transmembrane protease serine 11G OS=Rattus norvegicus GN=Tmprss11g PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
193575579 393 PREDICTED: proclotting enzyme-like isofo 0.576 0.269 0.556 6e-30
56418413 605 hemolymph proteinase 17 [Manduca sexta] 0.570 0.173 0.5 2e-23
56418415 394 hemolymph proteinase 17 short form [Mand 0.570 0.266 0.5 4e-23
389612194155 serine protease, partial [Papilio xuthus 0.570 0.677 0.526 7e-23
66507455 353 PREDICTED: venom protease [Apis mellifer 0.548 0.286 0.539 2e-22
129688 375 RecName: Full=Proclotting enzyme; Contai 0.668 0.328 0.441 2e-22
345480475 369 PREDICTED: proclotting enzyme [Nasonia v 0.570 0.284 0.5 3e-22
350417089 359 PREDICTED: venom protease-like [Bombus i 0.548 0.281 0.539 4e-22
156551354 351 PREDICTED: venom protease [Nasonia vitri 0.570 0.299 0.485 4e-22
112982842 390 clip domain serine protease 4 precursor 0.570 0.269 0.5 6e-22
>gi|193575579|ref|XP_001951870.1| PREDICTED: proclotting enzyme-like isoform 1 [Acyrthosiphon pisum] gi|328709820|ref|XP_003244077.1| PREDICTED: proclotting enzyme-like isoform 2 [Acyrthosiphon pisum] gi|328709822|ref|XP_003244078.1| PREDICTED: proclotting enzyme-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 59/106 (55%), Positives = 84/106 (79%)

Query: 79  GSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGG 138
           GS    GP S  L  VQ+ V+DN +C++ F+N  + I++ +LCAG+L+GGKD+C GDSGG
Sbjct: 286 GSTSFRGPSSTHLMEVQVPVMDNSECKRAFANKKSVIDDRVLCAGILTGGKDACQGDSGG 345

Query: 139 PLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS 184
           PLM+P  ++YY++GVVSYG KCAE G+PGVYTRV ++++WIADN++
Sbjct: 346 PLMWPSGSQYYLVGVVSYGFKCAEPGYPGVYTRVASFVEWIADNMN 391




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|56418413|gb|AAV91014.1| hemolymph proteinase 17 [Manduca sexta] Back     alignment and taxonomy information
>gi|56418415|gb|AAV91015.1| hemolymph proteinase 17 short form [Manduca sexta] Back     alignment and taxonomy information
>gi|389612194|dbj|BAM19612.1| serine protease, partial [Papilio xuthus] Back     alignment and taxonomy information
>gi|66507455|ref|XP_623069.1| PREDICTED: venom protease [Apis mellifera] Back     alignment and taxonomy information
>gi|129688|sp|P21902.1|PCE_TACTR RecName: Full=Proclotting enzyme; Contains: RecName: Full=Proclotting enzyme light chain; Contains: RecName: Full=Proclotting enzyme heavy chain; Flags: Precursor gi|161658|gb|AAA30094.1| proclotting enzyme [Tachypleus tridentatus] Back     alignment and taxonomy information
>gi|345480475|ref|XP_001602546.2| PREDICTED: proclotting enzyme [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350417089|ref|XP_003491251.1| PREDICTED: venom protease-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|156551354|ref|XP_001602600.1| PREDICTED: venom protease [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|112982842|ref|NP_001036891.1| clip domain serine protease 4 precursor [Bombyx mori] gi|20372973|dbj|BAB91156.1| serine protease [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
UNIPROTKB|E1BZN8569 HGFAC "Uncharacterized protein 0.505 0.163 0.372 1.3e-13
UNIPROTKB|E1BJM8417 LOC518437 "Uncharacterized pro 0.478 0.211 0.377 1.1e-12
FB|FBgn0038727721 CG7432 [Drosophila melanogaste 0.478 0.122 0.395 1.1e-12
UNIPROTKB|J9P5A1107 J9P5A1 "Uncharacterized protei 0.478 0.822 0.355 1.9e-12
RGD|70909653 Hgfac "HGF activator" [Rattus 0.472 0.133 0.363 4.8e-12
UNIPROTKB|Q28661458 PROC "Vitamin K-dependent prot 0.489 0.196 0.311 6.6e-12
MGI|MGI:2444058417 Tmprss11g "transmembrane prote 0.505 0.223 0.347 6.6e-12
UNIPROTKB|F1RUS4417 LOC100738056 "Uncharacterized 0.478 0.211 0.355 8.5e-12
UNIPROTKB|E1BCW0297 HGFAC "Uncharacterized protein 0.847 0.525 0.289 9e-12
MGI|MGI:1918253322 Prss41 "protease, serine, 41" 0.483 0.276 0.329 9.2e-12
UNIPROTKB|E1BZN8 HGFAC "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 168 (64.2 bits), Expect = 1.3e-13, Sum P(2) = 1.3e-13
 Identities = 35/94 (37%), Positives = 47/94 (50%)

Query:    91 LRHVQISVVDNPKCRQIFSNYGATINENILCAGVLXXXXXXXXXXXXXPLMYPLDTKYYI 150
             L+   I ++   KCR     YG  I+EN+ CAG               PL    +   Y+
Sbjct:   472 LQETLIPLIPEEKCRSP-EIYGTEISENMFCAGYFDSKSDACQGDSGGPLACEKNEISYL 530

Query:   151 IGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS 184
              GV+S+G  C  V  PGVYTRVTNY+ WI + I+
Sbjct:   531 YGVISWGDGCGRVNKPGVYTRVTNYVNWINERIA 564


GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0005576 "extracellular region" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0005791 "rough endoplasmic reticulum" evidence=IEA
UNIPROTKB|E1BJM8 LOC518437 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0038727 CG7432 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|J9P5A1 J9P5A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|70909 Hgfac "HGF activator" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q28661 PROC "Vitamin K-dependent protein C" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
MGI|MGI:2444058 Tmprss11g "transmembrane protease, serine 11g" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUS4 LOC100738056 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BCW0 HGFAC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1918253 Prss41 "protease, serine, 41" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 1e-36
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 2e-35
pfam00089218 pfam00089, Trypsin, Trypsin 2e-23
COG5640 413 COG5640, COG5640, Secreted trypsin-like serine pro 9e-13
>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
 Score =  126 bits (319), Expect = 1e-36
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 79  GSVPGGGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGG 138
           G    GGPL   L+ V + +V N +C++ +S YG TI +N+LCAG L GGKD+C GDSGG
Sbjct: 130 GRTSEGGPLPDVLQEVNVPIVSNAECKRAYS-YGGTITDNMLCAGGLEGGKDACQGDSGG 188

Query: 139 PLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADN 182
           PL+   + +  ++G+VS+G  CA   +PGVYTRV++Y+ WI   
Sbjct: 189 PLVCNDNGRGVLVGIVSWGSGCARPNYPGVYTRVSSYLDWIQKT 232


Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues. Length = 232

>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
KOG3627|consensus256 100.0
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 99.97
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 99.95
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 99.93
COG5640 413 Secreted trypsin-like serine protease [Posttransla 99.75
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 98.72
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 97.61
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 94.48
TIGR02038 351 protease_degS periplasmic serine pepetdase DegS. T 94.35
PRK10139 455 serine endoprotease; Provisional 94.07
PRK10898 353 serine endoprotease; Provisional 94.05
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 92.9
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 92.34
PRK10942 473 serine endoprotease; Provisional 91.53
>KOG3627|consensus Back     alignment and domain information
Probab=100.00  E-value=1.5e-31  Score=206.46  Aligned_cols=162  Identities=33%  Similarity=0.697  Sum_probs=136.0

Q ss_pred             CCceEEEcCCCCC---C-CCeEEEEeceecccCcccccccCCcccCCCCCCCcccCCCCCceeccCCCCeeeeEeecccC
Q psy17330          7 PDSSLHVIPSISD---D-SHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVP   82 (184)
Q Consensus         7 ~~~~i~~Hp~y~~---~-~DiAllkL~~~~~~~~~~~~~l~~~~~~~~~v~piCllp~~~~~~~~~~~~~~~~~Gwg~~~   82 (184)
                      .+.++++||+|+.   . +|||||+|.+++.              |+++|+||| ||..........+..|+++|||.+.
T Consensus        88 ~v~~~i~H~~y~~~~~~~nDiall~l~~~v~--------------~~~~i~pic-lp~~~~~~~~~~~~~~~v~GWG~~~  152 (256)
T KOG3627|consen   88 DVEKIIVHPNYNPRTLENNDIALLRLSEPVT--------------FSSHIQPIC-LPSSADPYFPPGGTTCLVSGWGRTE  152 (256)
T ss_pred             eeeEEEECCCCCCCCCCCCCEEEEEECCCcc--------------cCCcccccC-CCCCcccCCCCCCCEEEEEeCCCcC
Confidence            4568889999966   3 8999999999988              999999999 7754433234555899999999987


Q ss_pred             CC-CCCCcCceEEEEEeeCcccccccccccCCCCCCCeEEeeecCCCCCCCCCCCCCeeEEEeCCeEEEEEEEEecCC-C
Q psy17330         83 GG-GPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKK-C  160 (184)
Q Consensus        83 ~~-~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~C~~~~~~~~~~c~~d~G~pl~~~~~~~~~L~Gi~s~~~~-c  160 (184)
                      .. ...+..|++.++++++.++|...+... ..+++.++|++......+.|+||+||||++..+++|+|+||+|||.. |
T Consensus       153 ~~~~~~~~~L~~~~v~i~~~~~C~~~~~~~-~~~~~~~~Ca~~~~~~~~~C~GDSGGPLv~~~~~~~~~~GivS~G~~~C  231 (256)
T KOG3627|consen  153 SGGGPLPDTLQEVDVPIISNSECRRAYGGL-GTITDTMLCAGGPEGGKDACQGDSGGPLVCEDNGRWVLVGIVSWGSGGC  231 (256)
T ss_pred             CCCCCCCceeEEEEEeEcChhHhcccccCc-cccCCCEEeeCccCCCCccccCCCCCeEEEeeCCcEEEEEEEEecCCCC
Confidence            65 245778999999999999999988621 14667789998556677789999999999998889999999999988 9


Q ss_pred             CCCCCCeEEEeCcchHHHHHhhhC
Q psy17330        161 AEVGFPGVYTRVTNYIQWIADNIS  184 (184)
Q Consensus       161 ~~~~~p~vft~v~~~~~WI~~~i~  184 (184)
                      .....|++||||+.|.+||++.+.
T Consensus       232 ~~~~~P~vyt~V~~y~~WI~~~~~  255 (256)
T KOG3627|consen  232 GQPNYPGVYTRVSSYLDWIKENIG  255 (256)
T ss_pred             CCCCCCeEEeEhHHhHHHHHHHhc
Confidence            987799999999999999998763



>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
1ybw_A283 Protease Domain Of Hgfa With No Inhibitor Length = 7e-11
2wub_A257 Crystal Structure Of Hgfa In Complex With The Allos 7e-11
2r0l_A248 Short Form Hgfa With Inhibitory Fab75 Length = 248 7e-11
1aut_C250 Human Activated Protein C Length = 250 3e-10
3f6u_H240 Crystal Structure Of Human Activated Protein C (Apc 4e-10
4dgj_A235 Structure Of A Human Enteropeptidase Light Chain Va 2e-09
1ekb_B235 The Serine Protease Domain Of Enteropeptidase Bound 6e-09
2f91_A237 1.2a Resolution Structure Of A Crayfish Trypsin Com 1e-08
2any_A241 Expression, Crystallization And The Three-Dimension 2e-08
2anw_A241 Expression, Crystallization And Three-Dimensional S 2e-08
1a5i_A265 Catalytic Domain Of Vampire Bat (Desmodus Rotundus) 2e-08
2oq5_A232 Crystal Structure Of Desc1, A New Member Of The Typ 2e-08
1kig_H241 Bovine Factor Xa Length = 241 3e-08
1rtf_B252 Complex Of Benzamidine With The Catalytic Domain Of 8e-08
1bda_A265 Catalytic Domain Of Human Single Chain Tissue Plasm 8e-08
1fax_A254 Coagulation Factor Xa Inhibitor Complex Length = 25 9e-08
2gd4_H241 Crystal Structure Of The Antithrombin-S195a Factor 9e-08
2bok_A241 Factor Xa- Cation Length = 241 9e-08
1ezq_A254 Crystal Structure Of Human Coagulation Factor Xa Co 9e-08
1hcg_A241 Structure Of Human Des(1-45) Factor Xa At 2.2 Angst 1e-07
1c5m_D255 Structural Basis For Selectivity Of A Small Molecul 1e-07
3ens_B238 Crystal Structure Of Human Fxa In Complex With Meth 1e-07
2bq6_B249 Crystal Structure Of Factor Xa In Complex With 21 L 1e-07
1xka_C235 Factor Xa Complexed With A Synthetic Inhibitor Fx-2 1e-07
1fjs_A234 Crystal Structure Of The Inhibitor Zk-807834 (Ci-10 1e-07
2y5f_A234 Factor Xa - Cation Inhibitor Complex Length = 234 1e-07
1mq5_A233 Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-ch 1e-07
1zlr_A237 Factor Xi Catalytic Domain Complexed With 2-Guanidi 1e-07
1zjd_A237 Crystal Structure Of The Catalytic Domain Of Coagul 1e-07
1xxd_A238 Crystal Structure Of The Fxia Catalytic Domain In C 1e-07
1zhm_A238 Crystal Structure Of The Catalytic Domain Of The Co 1e-07
1zhp_A238 Crystal Structure Of The Catalytic Domain Of Coagul 1e-07
1xx9_A238 Crystal Structure Of The Fxia Catalytic Domain In C 1e-07
3sor_A238 Factor Xia In Complex With A Clorophenyl-tetrazole 1e-07
1zhr_A238 Crystal Structure Of The Catalytic Domain Of Coagul 1e-07
3bg8_A238 Crystal Structure Of Factor Xia In Complex With Cla 1e-07
1zpz_A238 Factor Xi Catalytic Domain Complexed With N-((R)-1- 1e-07
1zjk_A403 Crystal Structure Of The Zymogen Catalytic Region O 2e-07
2olg_A278 Crystal Structure Of The Serine Protease Domain Of 2e-07
1q3x_A328 Crystal Structure Of The Catalytic Region Of Human 2e-07
4fxg_H242 Complement C4 In Complex With Masp-2 Length = 242 2e-07
2f83_A625 Crystal Structure At 2.9 Angstroms Resolution Of Hu 2e-07
3tvj_B242 Catalytic Fragment Of Masp-2 In Complex With Its Sp 2e-07
3dfj_A263 Crystal Structure Of Human Prostasin Length = 263 2e-07
3gyl_B261 Structure Of Prostasin At 1.3 Angstroms Resolution 2e-07
3e0p_B271 The X-Ray Structure Of Human Prostasin In Complex W 2e-07
1bml_A250 Complex Of The Catalytic Domain Of Human Plasmin An 4e-07
1l4d_A249 Crystal Structure Of Microplasminogen-streptokinase 4e-07
3uir_A247 Crystal Structure Of The Plasmin-Textilinin-1 Compl 4e-07
1l4z_A248 X-Ray Crystal Structure Of The Complex Of Microplas 4e-07
1qrz_A246 Catalytic Domain Of Plasminogen Length = 246 4e-07
1bui_B250 Structure Of The Ternary Microplasmin-Staphylokinas 4e-07
1ddj_A247 Crystal Structure Of Human Plasminogen Catalytic Do 4e-07
2vnt_A276 Urokinase-Type Plasminogen Activator Inhibitor Comp 4e-07
2nwn_A253 New Pharmacophore For Serine Protease Inhibition Re 5e-07
1o5a_B253 Dissecting And Designing Inhibitor Selectivity Dete 5e-07
4fu7_A246 Crystal Structure Of The Urokinase Length = 246 5e-07
1gj7_B253 Engineering Inhibitors Highly Selective For The S1 5e-07
1owe_A245 Substituted 2-Naphthamidine Inhibitors Of Urokinase 5e-07
1ejn_A253 Urokinase Plasminogen Activator B-Chain Inhibitor C 5e-07
1w0z_U247 Urokinase Type Plasminogen Activator Length = 247 6e-07
1owd_A245 Substituted 2-naphthamidine Inhibitors Of Urokinase 6e-07
3ig6_B253 Low Molecular Weigth Human Urokinase Type Plasminog 6e-07
3mwi_U246 The Complex Crystal Structure Of Urokianse And 5-Ni 6e-07
1lmw_B253 Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-A 6e-07
1gi8_B245 A Novel Serine Protease Inhibition Motif Involving 6e-07
1sc8_U262 Urokinase Plasminogen Activator B-Chain-J435 Comple 6e-07
2o8u_A253 Crystal Structure And Binding Epitopes Of Urokinase 6e-07
1fv9_A245 Crystal Structure Of Human Microurokinase In Comple 6e-07
2wpm_S235 Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Le 6e-07
2wph_S235 Factor Ixa Superactive Triple Mutant Length = 235 6e-07
2wpi_S235 Factor Ixa Superactive Double Mutant Length = 235 6e-07
1ept_C98 Refined 1.8 Angstroms Resolution Crystal Structure 8e-07
1rjx_B247 Human Plasminogen Catalytic Domain, K698m Mutant Le 1e-06
1fxy_A228 Coagulation Factor Xa-Trypsin Chimera Inhibited Wit 1e-06
1pfx_C235 Porcine Factor Ixa Length = 235 1e-06
3kcg_H235 Crystal Structure Of The Antithrombin-Factor Ixa- P 1e-06
1rfn_A235 Human Coagulation Factor Ixa In Complex With P-Amin 1e-06
2d8w_A223 Structure Of Hyper-Vil-Trypsin Length = 223 1e-06
1ntp_A223 Use Of The Neutron Diffraction HD EXCHANGE TECHNIQU 2e-06
1trn_A224 Crystal Structure Of Human Trypsin 1: Unexpected Ph 2e-06
1mct_A223 The Refined 1.6 Angstroms Resolution Crystal Struct 2e-06
4dur_A791 The X-Ray Crystal Structure Of Full-Length Type Ii 2e-06
3ela_H254 Crystal Structure Of Active Site Inhibited Coagulat 2e-06
2ra3_A224 Human Cationic Trypsin Complexed With Bovine Pancre 2e-06
3otj_E223 A Crystal Structure Of Trypsin Complexed With Bpti 2e-06
1dan_H254 Complex Of Active Site Inhibited Human Blood Coagul 2e-06
3qk1_A229 Crystal Structure Of Enterokinase-Like Trypsin Vari 2e-06
1zzz_A237 Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes 2e-06
1oph_B243 Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh 2e-06
2ftm_A224 Crystal Structure Of A Bpti Variant (Cys38->ser) In 2e-06
3veq_B223 A Binary Complex Betwwen Bovine Pancreatic Trypsin 2e-06
1f0t_A243 Bovine Trypsin Complexed With Rpr131247 Length = 24 2e-06
2fi4_E223 Crystal Structure Of A Bpti Variant (Cys14->ser) In 2e-06
1y59_T223 Dianhydrosugar-Based Benzamidine, Factor Xa Specifi 2e-06
1tab_E223 Structure Of The Trypsin-Binding Domain Of Bowman-B 2e-06
1g3b_A228 Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Ba 2e-06
1tgs_Z229 Three-Dimensional Structure Of The Complex Between 2e-06
5ptp_A223 Structure Of Hydrolase (Serine Proteinase) Length = 2e-06
1taw_A223 Bovine Trypsin Complexed To Appi Length = 223 3e-06
1uhb_B98 Crystal Structure Of Porcine Alpha Trypsin Bound Wi 3e-06
2f9n_A245 Crystal Structure Of The Recombinant Human Alpha I 3e-06
2f9o_A245 Crystal Structure Of The Recombinant Human Alpha I 3e-06
1a0j_A223 Crystal Structure Of A Non-Psychrophilic Trypsin Fr 4e-06
2zeb_A243 Potent, Nonpeptide Inhibitors Of Human Mast Cell Tr 4e-06
2bm2_A245 Human Beta-Ii Tryptase In Complex With 4-(3-Aminome 4e-06
4an7_A231 Kunitz Type Trypsin Inhibitor Complex With Porcine 4e-06
1a0l_A244 Human Beta-Tryptase: A Ring-Like Tetramer With Acti 4e-06
2a31_A223 Trypsin In Complex With Borate Length = 223 5e-06
1an1_E223 Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Len 5e-06
1tfx_A223 Complex Of The Second Kunitz Domain Of Tissue Facto 5e-06
1mtn_C97 Bovine Alpha-Chymotrypsin:bpti Crystallization Leng 7e-06
1afq_C96 Crystal Structure Of Bovine Gamma-Chymotrypsin Comp 7e-06
1v2u_T223 Benzamidine In Complex With Bovine Trypsin Varinat 9e-06
2cga_A245 Bovine Chymotrypsinogen A. X-Ray Crystal Structure 9e-06
3myw_A223 The Bowman-Birk Type Inhibitor From Mung Bean In Te 9e-06
2r9p_A224 Human Mesotrypsin Complexed With Bovine Pancreatic 9e-06
1fy8_E231 Crystal Structure Of The Deltaile16val17 Rat Anioni 1e-05
1f5r_A231 Rat Trypsinogen Mutant Complexed With Bovine Pancre 1e-05
1h4w_A224 Structure Of Human Trypsin Iv (Brain Trypsin) Lengt 1e-05
3tgk_E231 Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 1e-05
2xrc_A565 Human Complement Factor I Length = 565 1e-05
1dlk_B230 Crystal Structure Analysis Of Delta-Chymotrypsin Bo 1e-05
4dg4_A224 Human Mesotrypsin-S39y Complexed With Bovine Pancre 1e-05
3tgj_E233 S195a Trypsinogen Complexed With Bovine Pancreatic 1e-05
1f7z_A233 Rat Trypsinogen K15a Complexed With Bovine Pancreat 1e-05
1slx_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 1e-05
1amh_A223 Uncomplexed Rat Trypsin Mutant With Asp 189 Replace 1e-05
1slw_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 1e-05
1co7_E245 R117h Mutant Rat Anionic Trypsin Complexed With Bov 1e-05
1and_A223 Anionic Trypsin Mutant With Arg 96 Replaced By His 1e-05
1k9o_E223 Crystal Structure Of Michaelis Serpin-Trypsin Compl 1e-05
1ezs_C223 Crystal Structure Of Ecotin Mutant M84r, W67a, G68a 1e-05
3tgi_E223 Wild-Type Rat Anionic Trypsin Complexed With Bovine 1e-05
1ql9_A223 Factor Xa Specific Inhibitor In Complex With Rat Tr 1e-05
1eaw_A241 Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A 1e-05
3bn9_B241 Crystal Structure Of Mt-Sp1 In Complex With Fab Inh 1e-05
1v2k_T223 Factor Xa Specific Inhibitor In Complex With Bovine 1e-05
1trm_A223 The Three-Dimensional Structure Of Asn102 Mutant Of 1e-05
1v2s_T223 Benzamidine In Complex With Bovine Trypsin Variant 1e-05
4b2a_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 1e-05
1dpo_A223 Structure Of Rat Trypsin Length = 223 2e-05
1lto_A245 Human Alpha1-Tryptase Length = 245 2e-05
1v2j_T223 Benzamidine In Complex With Bovine Trypsin Variant 2e-05
4b1t_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 2e-05
1v2n_T223 Potent Factor Xa Inhibitor In Complex With Bovine T 2e-05
1v2q_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 2e-05
3p8g_A241 Crystal Structure Of Mt-Sp1 In Complex With Benzami 2e-05
1v2o_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 2e-05
3pwb_A223 Bovine Trypsin Variant X(Tripleglu217ile227) In Com 2e-05
1fiw_A290 Three-Dimensional Structure Of Beta-Acrosin From Ra 2e-05
3plk_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 3e-05
3pmj_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 3e-05
2jet_C99 Crystal Structure Of A Trypsin-Like Mutant (S189d, 3e-05
1dst_A228 Mutant Of Factor D With Enhanced Catalytic Activity 3e-05
1anb_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Glu 3e-05
1j15_A223 Benzamidine In Complex With Rat Trypsin Mutant X991 4e-05
1anc_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Lys 4e-05
1ym0_A238 Crystal Structure Of Earthworm Fibrinolytic Enzyme 4e-05
4b2b_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 5e-05
4b2c_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 7e-05
3uns_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 7e-05
3uqv_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 7e-05
1brb_E223 Crystal Structures Of Rat Anionic Trypsin Complexed 8e-05
1si5_H240 Protease-Like Domain From 2-Chain Hepatocyte Growth 9e-05
1shy_A234 The Crystal Structure Of Hgf Beta-Chain In Complex 9e-05
1fiz_A263 Three Dimensional Structure Of Beta-Acrosin From Bo 1e-04
2xw9_A228 Crystal Structure Of Complement Factor D Mutant S18 1e-04
1thp_B259 Structure Of Human Alpha-Thrombin Y225p Mutant Boun 1e-04
1kdq_B99 Crystal Structure Analysis Of The Mutant S189d Rat 1e-04
1fdp_A235 Proenzyme Of Human Complement Factor D, Recombinant 1e-04
3unq_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 2e-04
1dsu_A228 Human Factor D, Complement Activating Enzyme Length 2e-04
3v0x_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 2e-04
3uwi_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 2e-04
1bqy_A234 Plasminogen Activator (tsv-pa) From Snake Venom Len 2e-04
2bdg_A223 Human Kallikrein 4 Complex With Nickel And P-aminob 2e-04
1z8g_A372 Crystal Structure Of The Extracellular Region Of Th 2e-04
3t2n_A372 Human Hepsin Protease In Complex With The Fab Fragm 2e-04
4d9q_A228 Inhibiting Alternative Pathway Complement Activatio 2e-04
1o5e_H255 Dissecting And Designing Inhibitor Selectivity Dete 3e-04
1pyt_C253 Ternary Complex Of Procarboxypeptidase A, Proprotei 3e-04
3gov_B251 Crystal Structure Of The Catalytic Region Of Human 3e-04
1pyt_D251 Ternary Complex Of Procarboxypeptidase A, Proprotei 3e-04
1hj9_A223 Atomic Resolution Structures Of Trypsin Provide Ins 3e-04
2xwa_A228 Crystal Structure Of Complement Factor D Mutant R20 3e-04
2tld_E220 Crystal Structure Of An Engineered Subtilisin Inhib 4e-04
1twx_B259 Crystal Structure Of The Thrombin Mutant D221aD222K 5e-04
4igd_A406 Crystal Structure Of The Zymogen Catalytic Region O 5e-04
1bru_P241 Structure Of Porcine Pancreatic Elastase Complexed 6e-04
1os8_A223 Recombinant Streptomyces Griseus Trypsin Length = 2 7e-04
1sgt_A223 Refined Crystal Structure Of Streptomyces Griseus T 7e-04
1fon_A240 Crystal Structure Of Bovine Procarboxypeptidase A-S 7e-04
1elv_A333 Crystal Structure Of The Catalytic Domain Of Human 8e-04
1eq9_A222 Crystal Structure Of Fire Ant Chymotrypsin Complexe 8e-04
1rd3_B259 2.5a Structure Of Anticoagulant Thrombin Variant E2 9e-04
>pdb|1YBW|A Chain A, Protease Domain Of Hgfa With No Inhibitor Length = 283 Back     alignment and structure

Iteration: 1

Score = 63.5 bits (153), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 34/93 (36%), Positives = 46/93 (49%), Gaps = 1/93 (1%) Query: 91 LRHVQISVVDNPKCRQIFSNYGATINENILCAGVLXXXXXXXXXXXXXPLMYPLDTKYYI 150 LR + +V + KC YGA I+ N+LCAG PL + Y+ Sbjct: 182 LREALVPLVADHKCSSP-EVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYL 240 Query: 151 IGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNI 183 G++S+G C + PGVYTRV NY+ WI D I Sbjct: 241 YGIISWGDGCGRLHKPGVYTRVANYVDWINDRI 273
>pdb|2WUB|A Chain A, Crystal Structure Of Hgfa In Complex With The Allosteric Non-Inhibitory Antibody Fab40.Deltatrp Length = 257 Back     alignment and structure
>pdb|2R0L|A Chain A, Short Form Hgfa With Inhibitory Fab75 Length = 248 Back     alignment and structure
>pdb|1AUT|C Chain C, Human Activated Protein C Length = 250 Back     alignment and structure
>pdb|3F6U|H Chain H, Crystal Structure Of Human Activated Protein C (Apc) Complexed With Ppack Length = 240 Back     alignment and structure
>pdb|4DGJ|A Chain A, Structure Of A Human Enteropeptidase Light Chain Variant Length = 235 Back     alignment and structure
>pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 Back     alignment and structure
>pdb|2F91|A Chain A, 1.2a Resolution Structure Of A Crayfish Trypsin Complexed With A Peptide Inhibitor, Sgti Length = 237 Back     alignment and structure
>pdb|2ANY|A Chain A, Expression, Crystallization And The Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|2ANW|A Chain A, Expression, Crystallization And Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|1A5I|A Chain A, Catalytic Domain Of Vampire Bat (Desmodus Rotundus) Saliva Plasminogen Activator In Complex With Egr-Cmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|2OQ5|A Chain A, Crystal Structure Of Desc1, A New Member Of The Type Ii Transmembrane Serine Proteinases Family Length = 232 Back     alignment and structure
>pdb|1KIG|H Chain H, Bovine Factor Xa Length = 241 Back     alignment and structure
>pdb|1RTF|B Chain B, Complex Of Benzamidine With The Catalytic Domain Of Human Two Chain Tissue Plasminogen Activator [(Tc)-T-Pa] Length = 252 Back     alignment and structure
>pdb|1BDA|A Chain A, Catalytic Domain Of Human Single Chain Tissue Plasminogen Activator In Complex With Dansyl-Egr-Cmk (Dansyl-Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|1FAX|A Chain A, Coagulation Factor Xa Inhibitor Complex Length = 254 Back     alignment and structure
>pdb|2GD4|H Chain H, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 241 Back     alignment and structure
>pdb|2BOK|A Chain A, Factor Xa- Cation Length = 241 Back     alignment and structure
>pdb|1EZQ|A Chain A, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 254 Back     alignment and structure
>pdb|1HCG|A Chain A, Structure Of Human Des(1-45) Factor Xa At 2.2 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|1C5M|D Chain D, Structural Basis For Selectivity Of A Small Molecule, S1- Binding, Sub-Micromolar Inhibitor Of Urokinase Type Plasminogen Activator Length = 255 Back     alignment and structure
>pdb|3ENS|B Chain B, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 238 Back     alignment and structure
>pdb|2BQ6|B Chain B, Crystal Structure Of Factor Xa In Complex With 21 Length = 249 Back     alignment and structure
>pdb|1XKA|C Chain C, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 235 Back     alignment and structure
>pdb|1FJS|A Chain A, Crystal Structure Of The Inhibitor Zk-807834 (Ci-1031) Complexed With Factor Xa Length = 234 Back     alignment and structure
>pdb|2Y5F|A Chain A, Factor Xa - Cation Inhibitor Complex Length = 234 Back     alignment and structure
>pdb|1MQ5|A Chain A, Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-chlorophenyl) Amino]carbonyl]phenyl]-4-[(4-methyl-1- piperazinyl)methyl]-2- Thiophenecarboxamide Complexed With Human Factor Xa Length = 233 Back     alignment and structure
>pdb|1ZLR|A Chain A, Factor Xi Catalytic Domain Complexed With 2-Guanidino-1-(4-(4,4,5,5- Tetramethyl-1,3,2-Dioxaborolan-2-Yl)phenyl)ethyl Nicotinate Length = 237 Back     alignment and structure
>pdb|1ZJD|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 237 Back     alignment and structure
>pdb|1XXD|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Mutated Ecotin Length = 238 Back     alignment and structure
>pdb|1ZHM|A Chain A, Crystal Structure Of The Catalytic Domain Of The Coagulation Factor Xia In Complex With Benzamidine (s434a- T475a-k437 Mutant) Length = 238 Back     alignment and structure
>pdb|1ZHP|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-K505 Mutant) Length = 238 Back     alignment and structure
>pdb|1XX9|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Ecotinm84r Length = 238 Back     alignment and structure
>pdb|3SOR|A Chain A, Factor Xia In Complex With A Clorophenyl-tetrazole Inhibitor Length = 238 Back     alignment and structure
>pdb|1ZHR|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-C482s-K437a Mutant) Length = 238 Back     alignment and structure
>pdb|3BG8|A Chain A, Crystal Structure Of Factor Xia In Complex With Clavatadine A Length = 238 Back     alignment and structure
>pdb|1ZPZ|A Chain A, Factor Xi Catalytic Domain Complexed With N-((R)-1-(4- Bromophenyl)ethyl)urea-Asn-Val-Arg-Alpha-Ketothiazole Length = 238 Back     alignment and structure
>pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 Back     alignment and structure
>pdb|2OLG|A Chain A, Crystal Structure Of The Serine Protease Domain Of Prophenoloxidase Activating Factor-I In A Zymogen Form Length = 278 Back     alignment and structure
>pdb|1Q3X|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-2 Length = 328 Back     alignment and structure
>pdb|4FXG|H Chain H, Complement C4 In Complex With Masp-2 Length = 242 Back     alignment and structure
>pdb|2F83|A Chain A, Crystal Structure At 2.9 Angstroms Resolution Of Human Plasma Coagulation Factor Xi Zymogen Length = 625 Back     alignment and structure
>pdb|3TVJ|B Chain B, Catalytic Fragment Of Masp-2 In Complex With Its Specific Inhibitor Developed By Directed Evolution On Sgci Scaffold Length = 242 Back     alignment and structure
>pdb|3DFJ|A Chain A, Crystal Structure Of Human Prostasin Length = 263 Back     alignment and structure
>pdb|3GYL|B Chain B, Structure Of Prostasin At 1.3 Angstroms Resolution In Complex With A Calcium Ion. Length = 261 Back     alignment and structure
>pdb|3E0P|B Chain B, The X-Ray Structure Of Human Prostasin In Complex With A Covalent Benzoxazole Inhibitor Length = 271 Back     alignment and structure
>pdb|1BML|A Chain A, Complex Of The Catalytic Domain Of Human Plasmin And Streptokinase Length = 250 Back     alignment and structure
>pdb|1L4D|A Chain A, Crystal Structure Of Microplasminogen-streptokinase Alpha Domain Complex Length = 249 Back     alignment and structure
>pdb|3UIR|A Chain A, Crystal Structure Of The Plasmin-Textilinin-1 Complex Length = 247 Back     alignment and structure
>pdb|1L4Z|A Chain A, X-Ray Crystal Structure Of The Complex Of Microplasminogen With Alpha Domain Of Streptokinase In The Presence Cadmium Ions Length = 248 Back     alignment and structure
>pdb|1QRZ|A Chain A, Catalytic Domain Of Plasminogen Length = 246 Back     alignment and structure
>pdb|1BUI|B Chain B, Structure Of The Ternary Microplasmin-Staphylokinase-Microplasmin Complex: A Proteinase-Cofactor-Substrate Complex In Action Length = 250 Back     alignment and structure
>pdb|1DDJ|A Chain A, Crystal Structure Of Human Plasminogen Catalytic Domain Length = 247 Back     alignment and structure
>pdb|2VNT|A Chain A, Urokinase-Type Plasminogen Activator Inhibitor Complex With A 1-(7-Sulphoamidoisoquinolinyl)guanidine Length = 276 Back     alignment and structure
>pdb|2NWN|A Chain A, New Pharmacophore For Serine Protease Inhibition Revealed By Crystal Structure Of Human Urokinase-Type Plasminogen Activator Complexed With A Cyclic Peptidyl Inhibitor, Upain-1 Length = 253 Back     alignment and structure
>pdb|1O5A|B Chain B, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 253 Back     alignment and structure
>pdb|4FU7|A Chain A, Crystal Structure Of The Urokinase Length = 246 Back     alignment and structure
>pdb|1GJ7|B Chain B, Engineering Inhibitors Highly Selective For The S1 Sites Of Ser190 Trypsin-Like Serine Protease Drug Targets Length = 253 Back     alignment and structure
>pdb|1OWE|A Chain A, Substituted 2-Naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1EJN|A Chain A, Urokinase Plasminogen Activator B-Chain Inhibitor Complex Length = 253 Back     alignment and structure
>pdb|1W0Z|U Chain U, Urokinase Type Plasminogen Activator Length = 247 Back     alignment and structure
>pdb|1OWD|A Chain A, Substituted 2-naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|3IG6|B Chain B, Low Molecular Weigth Human Urokinase Type Plasminogen Activator 2-[6- (3'-Aminomethyl-Biphenyl-3-Yloxy)-4-(3-Dimethylamino- Pyrrolidin-1- Yl)-3, 5-Difluoro-Pyridin-2-Yloxy]-4-Dimethylamino-Benzoic Acid Complex Length = 253 Back     alignment and structure
>pdb|3MWI|U Chain U, The Complex Crystal Structure Of Urokianse And 5-Nitro-1h-Indole-2- Amidine Length = 246 Back     alignment and structure
>pdb|1LMW|B Chain B, Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 253 Back     alignment and structure
>pdb|1GI8|B Chain B, A Novel Serine Protease Inhibition Motif Involving A Multi- Centered Short Hydrogen Bonding Network At The Active Site Length = 245 Back     alignment and structure
>pdb|1SC8|U Chain U, Urokinase Plasminogen Activator B-Chain-J435 Complex Length = 262 Back     alignment and structure
>pdb|2O8U|A Chain A, Crystal Structure And Binding Epitopes Of Urokinase-Type Plasminogen Activator (C122aN145QS195A) IN COMPLEX WITH Inhibitors Length = 253 Back     alignment and structure
>pdb|1FV9|A Chain A, Crystal Structure Of Human Microurokinase In Complex With 2- Amino-5-Hydroxy-Benzimidazole Length = 245 Back     alignment and structure
>pdb|2WPM|S Chain S, Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Length = 235 Back     alignment and structure
>pdb|2WPH|S Chain S, Factor Ixa Superactive Triple Mutant Length = 235 Back     alignment and structure
>pdb|2WPI|S Chain S, Factor Ixa Superactive Double Mutant Length = 235 Back     alignment and structure
>pdb|1EPT|C Chain C, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 98 Back     alignment and structure
>pdb|1RJX|B Chain B, Human Plasminogen Catalytic Domain, K698m Mutant Length = 247 Back     alignment and structure
>pdb|1FXY|A Chain A, Coagulation Factor Xa-Trypsin Chimera Inhibited With D-Phe-Pro-Arg- Chloromethylketone Length = 228 Back     alignment and structure
>pdb|1PFX|C Chain C, Porcine Factor Ixa Length = 235 Back     alignment and structure
>pdb|3KCG|H Chain H, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 235 Back     alignment and structure
>pdb|1RFN|A Chain A, Human Coagulation Factor Ixa In Complex With P-Amino Benzamidine Length = 235 Back     alignment and structure
>pdb|2D8W|A Chain A, Structure Of Hyper-Vil-Trypsin Length = 223 Back     alignment and structure
>pdb|1NTP|A Chain A, Use Of The Neutron Diffraction HD EXCHANGE TECHNIQUE TO Determine The Conformational Dynamics Of Trypsin Length = 223 Back     alignment and structure
>pdb|1TRN|A Chain A, Crystal Structure Of Human Trypsin 1: Unexpected Phosphorylation Of Tyrosine 151 Length = 224 Back     alignment and structure
>pdb|1MCT|A Chain A, The Refined 1.6 Angstroms Resolution Crystal Structure Of The Complex Formed Between Porcine Beta-trypsin And Mcti-a, A Trypsin Inhibitor Of Squash Family Length = 223 Back     alignment and structure
>pdb|4DUR|A Chain A, The X-Ray Crystal Structure Of Full-Length Type Ii Human Plasminogen Length = 791 Back     alignment and structure
>pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|2RA3|A Chain A, Human Cationic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (bpti) Length = 224 Back     alignment and structure
>pdb|3OTJ|E Chain E, A Crystal Structure Of Trypsin Complexed With Bpti (Bovine Pancreatic Trypsin Inhibitor) By X-RayNEUTRON JOINT REFINEMENT Length = 223 Back     alignment and structure
>pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|3QK1|A Chain A, Crystal Structure Of Enterokinase-Like Trypsin Variant Length = 229 Back     alignment and structure
>pdb|1ZZZ|A Chain A, Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes Length = 237 Back     alignment and structure
>pdb|1OPH|B Chain B, Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh And S195a Trypsin Length = 243 Back     alignment and structure
>pdb|3VEQ|B Chain B, A Binary Complex Betwwen Bovine Pancreatic Trypsin And A Engineered Mutant Trypsin Inhibitor Length = 223 Back     alignment and structure
>pdb|1F0T|A Chain A, Bovine Trypsin Complexed With Rpr131247 Length = 243 Back     alignment and structure
>pdb|2FI4|E Chain E, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 223 Back     alignment and structure
>pdb|1Y59|T Chain T, Dianhydrosugar-Based Benzamidine, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Mutant Length = 223 Back     alignment and structure
>pdb|1TAB|E Chain E, Structure Of The Trypsin-Binding Domain Of Bowman-Birk Type Protease Inhibitor And Its Interaction With Trypsin Length = 223 Back     alignment and structure
>pdb|1G3B|A Chain A, Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Base Magnesium(Ii) Chelate Length = 228 Back     alignment and structure
>pdb|1TGS|Z Chain Z, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 229 Back     alignment and structure
>pdb|5PTP|A Chain A, Structure Of Hydrolase (Serine Proteinase) Length = 223 Back     alignment and structure
>pdb|1TAW|A Chain A, Bovine Trypsin Complexed To Appi Length = 223 Back     alignment and structure
>pdb|1UHB|B Chain B, Crystal Structure Of Porcine Alpha Trypsin Bound With Auto Catalyticaly Produced Native Peptide At 2.15 A Resolution Length = 98 Back     alignment and structure
>pdb|2F9N|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant K192qD216G IN COMPLEX WITH LEUPEPTIN Length = 245 Back     alignment and structure
>pdb|2F9O|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant D216g Length = 245 Back     alignment and structure
>pdb|1A0J|A Chain A, Crystal Structure Of A Non-Psychrophilic Trypsin From A Cold-Adapted Fish Species. Length = 223 Back     alignment and structure
>pdb|2ZEB|A Chain A, Potent, Nonpeptide Inhibitors Of Human Mast Cell Tryptase Length = 243 Back     alignment and structure
>pdb|2BM2|A Chain A, Human Beta-Ii Tryptase In Complex With 4-(3-Aminomethyl- Phenyl)-Piperidin-1-Yl-(5-Phenethyl- Pyridin-3-Yl)- Methanone Length = 245 Back     alignment and structure
>pdb|4AN7|A Chain A, Kunitz Type Trypsin Inhibitor Complex With Porcine Trypsin Length = 231 Back     alignment and structure
>pdb|1A0L|A Chain A, Human Beta-Tryptase: A Ring-Like Tetramer With Active Sites Facing A Central Pore Length = 244 Back     alignment and structure
>pdb|2A31|A Chain A, Trypsin In Complex With Borate Length = 223 Back     alignment and structure
>pdb|1AN1|E Chain E, Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Length = 223 Back     alignment and structure
>pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|1MTN|C Chain C, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 97 Back     alignment and structure
>pdb|1AFQ|C Chain C, Crystal Structure Of Bovine Gamma-Chymotrypsin Complexed With A Synthetic Inhibitor Length = 96 Back     alignment and structure
>pdb|1V2U|T Chain T, Benzamidine In Complex With Bovine Trypsin Varinat X(Ssai) Bt.D1 Length = 223 Back     alignment and structure
>pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|3MYW|A Chain A, The Bowman-Birk Type Inhibitor From Mung Bean In Ternary Complex With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|2R9P|A Chain A, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor(Bpti) Length = 224 Back     alignment and structure
>pdb|1FY8|E Chain E, Crystal Structure Of The Deltaile16val17 Rat Anionic Trypsinogen-Bpti Complex Length = 231 Back     alignment and structure
>pdb|1F5R|A Chain A, Rat Trypsinogen Mutant Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 231 Back     alignment and structure
>pdb|1H4W|A Chain A, Structure Of Human Trypsin Iv (Brain Trypsin) Length = 224 Back     alignment and structure
>pdb|3TGK|E Chain E, Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 17 Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 231 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 Back     alignment and structure
>pdb|4DG4|A Chain A, Human Mesotrypsin-S39y Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 224 Back     alignment and structure
>pdb|3TGJ|E Chain E, S195a Trypsinogen Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 233 Back     alignment and structure
>pdb|1F7Z|A Chain A, Rat Trypsinogen K15a Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 233 Back     alignment and structure
>pdb|1SLX|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Zinc-Bound Length = 223 Back     alignment and structure
>pdb|1AMH|A Chain A, Uncomplexed Rat Trypsin Mutant With Asp 189 Replaced With Ser (D189s) Length = 223 Back     alignment and structure
>pdb|1SLW|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Nickel- Bound Length = 223 Back     alignment and structure
>pdb|1CO7|E Chain E, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 245 Back     alignment and structure
>pdb|1AND|A Chain A, Anionic Trypsin Mutant With Arg 96 Replaced By His Length = 223 Back     alignment and structure
>pdb|1K9O|E Chain E, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 223 Back     alignment and structure
>pdb|1EZS|C Chain C, Crystal Structure Of Ecotin Mutant M84r, W67a, G68a, Y69a, D70a Bound To Rat Anionic Trypsin Ii Length = 223 Back     alignment and structure
>pdb|3TGI|E Chain E, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 223 Back     alignment and structure
>pdb|1QL9|A Chain A, Factor Xa Specific Inhibitor In Complex With Rat Trypsin Mutant X99rt Length = 223 Back     alignment and structure
>pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 Back     alignment and structure
>pdb|3BN9|B Chain B, Crystal Structure Of Mt-Sp1 In Complex With Fab Inhibitor E2 Length = 241 Back     alignment and structure
>pdb|1V2K|T Chain T, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Variant X(Triple.Glu)bt.D2 Length = 223 Back     alignment and structure
>pdb|1TRM|A Chain A, The Three-Dimensional Structure Of Asn102 Mutant Of Trypsin. Role Of Asp102 In Serine Protease Catalysis Length = 223 Back     alignment and structure
>pdb|1V2S|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssfi.Glu)bt.D1 Length = 223 Back     alignment and structure
>pdb|4B2A|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tga) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1DPO|A Chain A, Structure Of Rat Trypsin Length = 223 Back     alignment and structure
>pdb|1LTO|A Chain A, Human Alpha1-Tryptase Length = 245 Back     alignment and structure
>pdb|1V2J|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssri) Bt.C1 Length = 223 Back     alignment and structure
>pdb|4B1T|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala ( Ta) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1V2N|T Chain T, Potent Factor Xa Inhibitor In Complex With Bovine Trypsin Variant X(99175190)BT Length = 223 Back     alignment and structure
>pdb|1V2Q|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Sswi)bt.B4 Length = 223 Back     alignment and structure
>pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 Back     alignment and structure
>pdb|1V2O|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Ssyi)bt.B4 Length = 223 Back     alignment and structure
>pdb|3PWB|A Chain A, Bovine Trypsin Variant X(Tripleglu217ile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1FIW|A Chain A, Three-Dimensional Structure Of Beta-Acrosin From Ram Spermatozoa Length = 290 Back     alignment and structure
>pdb|3PLK|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3PMJ|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|2JET|C Chain C, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 99 Back     alignment and structure
>pdb|1DST|A Chain A, Mutant Of Factor D With Enhanced Catalytic Activity Length = 228 Back     alignment and structure
>pdb|1ANB|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Glu Length = 223 Back     alignment and structure
>pdb|1J15|A Chain A, Benzamidine In Complex With Rat Trypsin Mutant X99175190RT Length = 223 Back     alignment and structure
>pdb|1ANC|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Lys Length = 223 Back     alignment and structure
>pdb|1YM0|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component B: A Novel, Glycosylated Two-chained Trypsin Length = 238 Back     alignment and structure
>pdb|4B2B|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tgpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B2C|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|3UNS|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UQV|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1BRB|E Chain E, Crystal Structures Of Rat Anionic Trypsin Complexed With The Protein Inhibitors Appi And Bpti Length = 223 Back     alignment and structure
>pdb|1SI5|H Chain H, Protease-Like Domain From 2-Chain Hepatocyte Growth Factor Length = 240 Back     alignment and structure
>pdb|1SHY|A Chain A, The Crystal Structure Of Hgf Beta-Chain In Complex With The Sema Domain Of The Met Receptor Length = 234 Back     alignment and structure
>pdb|1FIZ|A Chain A, Three Dimensional Structure Of Beta-Acrosin From Boar Spermatozoa Length = 263 Back     alignment and structure
>pdb|2XW9|A Chain A, Crystal Structure Of Complement Factor D Mutant S183a Length = 228 Back     alignment and structure
>pdb|1THP|B Chain B, Structure Of Human Alpha-Thrombin Y225p Mutant Bound To D-Phe-Pro-Arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1KDQ|B Chain B, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 99 Back     alignment and structure
>pdb|1FDP|A Chain A, Proenzyme Of Human Complement Factor D, Recombinant Profactor D Length = 235 Back     alignment and structure
>pdb|3UNQ|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1DSU|A Chain A, Human Factor D, Complement Activating Enzyme Length = 228 Back     alignment and structure
>pdb|3V0X|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UWI|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1BQY|A Chain A, Plasminogen Activator (tsv-pa) From Snake Venom Length = 234 Back     alignment and structure
>pdb|2BDG|A Chain A, Human Kallikrein 4 Complex With Nickel And P-aminobenzamidine Length = 223 Back     alignment and structure
>pdb|1Z8G|A Chain A, Crystal Structure Of The Extracellular Region Of The Transmembrane Serine Protease Hepsin With Covalently Bound Preferred Substrate Length = 372 Back     alignment and structure
>pdb|3T2N|A Chain A, Human Hepsin Protease In Complex With The Fab Fragment Of An Inhibitory Antibody Length = 372 Back     alignment and structure
>pdb|4D9Q|A Chain A, Inhibiting Alternative Pathway Complement Activation By Targeting The Exosite On Factor D Length = 228 Back     alignment and structure
>pdb|1O5E|H Chain H, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (ala190 Upa) Length = 255 Back     alignment and structure
>pdb|1PYT|C Chain C, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 253 Back     alignment and structure
>pdb|3GOV|B Chain B, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 251 Back     alignment and structure
>pdb|1PYT|D Chain D, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 251 Back     alignment and structure
>pdb|1HJ9|A Chain A, Atomic Resolution Structures Of Trypsin Provide Insight Into Structural Radiation Damage Length = 223 Back     alignment and structure
>pdb|2XWA|A Chain A, Crystal Structure Of Complement Factor D Mutant R202a Length = 228 Back     alignment and structure
>pdb|2TLD|E Chain E, Crystal Structure Of An Engineered Subtilisin Inhibitor Complexed With Bovine Trypsin Length = 220 Back     alignment and structure
>pdb|1TWX|B Chain B, Crystal Structure Of The Thrombin Mutant D221aD222K Length = 259 Back     alignment and structure
>pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 Back     alignment and structure
>pdb|1BRU|P Chain P, Structure Of Porcine Pancreatic Elastase Complexed With The Elastase Inhibitor Gr143783 Length = 241 Back     alignment and structure
>pdb|1OS8|A Chain A, Recombinant Streptomyces Griseus Trypsin Length = 223 Back     alignment and structure
>pdb|1SGT|A Chain A, Refined Crystal Structure Of Streptomyces Griseus Trypsin At 1.7 Angstroms Resolution Length = 223 Back     alignment and structure
>pdb|1FON|A Chain A, Crystal Structure Of Bovine Procarboxypeptidase A-S6 Subunit Iii, A Highly Structured Truncated Zymogen E Length = 240 Back     alignment and structure
>pdb|1ELV|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Complement C1s Protease Length = 333 Back     alignment and structure
>pdb|1EQ9|A Chain A, Crystal Structure Of Fire Ant Chymotrypsin Complexed To Pmsf Length = 222 Back     alignment and structure
>pdb|1RD3|B Chain B, 2.5a Structure Of Anticoagulant Thrombin Variant E217k Length = 259 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 2e-44
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 7e-42
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 3e-41
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 3e-41
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 2e-40
3bg8_A238 Coagulation factor XIA light chain; protease inhib 3e-40
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 5e-40
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 3e-39
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 8e-39
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 1e-38
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 1e-38
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 2e-38
2xxl_A408 GRAM-positive specific serine protease, isoform B; 4e-38
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 5e-38
2r0l_A248 Hepatocyte growth factor activator; serine proteas 8e-38
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 9e-38
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 9e-38
1aut_C250 Activated protein C; serine proteinase, plasma cal 1e-37
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 2e-37
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 2e-37
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 3e-37
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 4e-37
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 6e-37
2jde_A276 Urokinase-type plasminogen activator; plasminogen 9e-37
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 1e-36
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 2e-36
2asu_B234 Hepatocyte growth factor-like protein; serine prot 2e-36
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 2e-36
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 3e-36
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 4e-36
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 6e-36
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 6e-36
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 9e-36
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 9e-36
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 1e-35
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 2e-35
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 2e-35
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 2e-35
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 3e-35
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 3e-35
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 4e-35
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 5e-35
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 8e-35
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 1e-34
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 2e-34
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 2e-34
1ao5_A237 Glandular kallikrein-13; serine protease, protein 2e-34
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 2e-34
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 2e-34
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 3e-34
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 3e-34
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 4e-34
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 4e-34
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 6e-34
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 8e-34
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 8e-34
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 2e-33
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 2e-33
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 2e-33
2qy0_B242 Complement C1R subcomponent; serine protease, beta 2e-33
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 2e-33
2xw9_A228 Complement factor D; immune system, hydrolase, ser 2e-33
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 3e-33
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 3e-33
1euf_A227 Duodenase; serine protease, dual specificity, hydr 3e-33
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 6e-33
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 1e-32
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 2e-32
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 2e-32
2aiq_A231 Protein C activator; snake venom serine proteinase 2e-32
1md8_A329 C1R complement serine protease; innate immunity, a 2e-32
1azz_A226 Collagenase; complex (serine protease/inhibitor), 4e-32
1gpz_A399 Complement C1R component; hydrolase, activation, i 4e-32
2xrc_A565 Human complement factor I; immune system, hydrolas 5e-32
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 7e-32
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 7e-32
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 8e-32
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 8e-32
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 9e-32
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 1e-31
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-31
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 2e-31
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 2e-31
1elv_A333 Complement C1S component; trypsin-like serin prote 1e-30
2z7f_E218 Leukocyte elastase; serine protease, serine protea 3e-30
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 3e-30
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 4e-30
1a7s_A225 Heparin binding protein; serine protease homolog, 6e-30
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 5e-26
2odp_A509 Complement C2; C3/C5 convertase, complement serin 3e-24
3hrz_D741 Complement factor B; serine protease, glycosilated 6e-23
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 2e-06
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 6e-04
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
 Score =  147 bits (373), Expect = 2e-44
 Identities = 39/101 (38%), Positives = 57/101 (56%), Gaps = 2/101 (1%)

Query: 84  GGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYP 143
            G  S   + + + VV   +C + F   G  +  + LCAG     KDSCGGDSGGPL+  
Sbjct: 177 TGQYSTIKQKLAVPVVHAEQCAKTFGAAGVRVRSSQLCAGG-EKAKDSCGGDSGGPLLAE 235

Query: 144 -LDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNI 183
             + ++++ G+VS+G  C   G+PG+YT+V  Y  WI  NI
Sbjct: 236 RANQQFFLEGLVSFGATCGTEGWPGIYTKVGKYRDWIEGNI 276


>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Length = 218 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 100.0
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 100.0
3bg8_A238 Coagulation factor XIA light chain; protease inhib 100.0
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 100.0
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 100.0
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 100.0
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 100.0
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 100.0
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 100.0
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 100.0
1aut_C250 Activated protein C; serine proteinase, plasma cal 100.0
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 100.0
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 100.0
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 100.0
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 100.0
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 100.0
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 100.0
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 100.0
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 100.0
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 100.0
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 100.0
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 100.0
2r0l_A248 Hepatocyte growth factor activator; serine proteas 100.0
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 100.0
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 100.0
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 100.0
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 100.0
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 100.0
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 100.0
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 100.0
2asu_B234 Hepatocyte growth factor-like protein; serine prot 100.0
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 100.0
2jde_A276 Urokinase-type plasminogen activator; plasminogen 100.0
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 100.0
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 100.0
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 100.0
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 100.0
2qy0_B242 Complement C1R subcomponent; serine protease, beta 100.0
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 100.0
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 100.0
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 100.0
1ao5_A237 Glandular kallikrein-13; serine protease, protein 100.0
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 100.0
1elv_A333 Complement C1S component; trypsin-like serin prote 100.0
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 100.0
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 100.0
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 100.0
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 100.0
1euf_A227 Duodenase; serine protease, dual specificity, hydr 100.0
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 100.0
1md8_A329 C1R complement serine protease; innate immunity, a 100.0
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 100.0
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 100.0
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 100.0
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 100.0
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 100.0
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 100.0
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 100.0
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 100.0
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 100.0
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 100.0
2xxl_A408 GRAM-positive specific serine protease, isoform B; 100.0
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 100.0
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 100.0
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 100.0
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 100.0
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 100.0
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 100.0
2xw9_A228 Complement factor D; immune system, hydrolase, ser 100.0
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 100.0
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 100.0
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 100.0
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 100.0
1gpz_A399 Complement C1R component; hydrolase, activation, i 100.0
2aiq_A231 Protein C activator; snake venom serine proteinase 100.0
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 100.0
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 100.0
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 100.0
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 100.0
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 100.0
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 100.0
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 100.0
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 100.0
1azz_A226 Collagenase; complex (serine protease/inhibitor), 100.0
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 100.0
2z7f_E218 Leukocyte elastase; serine protease, serine protea 100.0
2xrc_A565 Human complement factor I; immune system, hydrolas 100.0
1a7s_A225 Heparin binding protein; serine protease homolog, 100.0
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 100.0
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 100.0
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.98
2odp_A509 Complement C2; C3/C5 convertase, complement serin 99.97
3hrz_D741 Complement factor B; serine protease, glycosilated 99.97
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 99.94
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 99.93
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.84
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 99.81
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 99.75
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.7
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.69
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.69
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.69
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.67
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.55
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 99.49
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.43
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.34
1hpg_A187 Glutamic acid specific protease; serine protease, 99.05
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 99.0
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.96
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 98.92
3k6y_A237 Serine protease, possible membrane-associated seri 98.91
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 98.89
1y8t_A 324 Hypothetical protein RV0983; serine protease, stru 98.75
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 98.7
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.69
1lcy_A 325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.67
1te0_A 318 Protease DEGS; two domains, serine protease, PDZ, 98.58
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 98.57
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 98.49
2oua_A188 Serine protease, protein NAPA; kinetic stability, 98.31
3stj_A 345 Protease DEGQ; serine protease, PDZ domain, protea 98.05
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.62
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.42
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 96.89
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 96.0
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 95.18
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 92.68
3syj_A 1011 Adhesion and penetration protein autotransporter; 86.47
3h09_A 989 IGA1 protease, immunoglobulin A1 protease; serine 81.58
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
Probab=100.00  E-value=5.9e-39  Score=243.71  Aligned_cols=158  Identities=31%  Similarity=0.589  Sum_probs=140.4

Q ss_pred             CceEEEcCCCCC---CCCeEEEEeceecccCcccccccCCcccCCCCCCCcccCCCCCceeccCCCCeeeeEeecccCCC
Q psy17330          8 DSSLHVIPSISD---DSHYQILHLEQRKKSKACKPSQLGGVARLPGPAGPGCSLPWGEFRLDLSSGGLRGPGCLGSVPGG   84 (184)
Q Consensus         8 ~~~i~~Hp~y~~---~~DiAllkL~~~~~~~~~~~~~l~~~~~~~~~v~piCllp~~~~~~~~~~~~~~~~~Gwg~~~~~   84 (184)
                      ++++++||+|+.   ++|||||||++|+.              ++++++||| ||...  .....+..|+++|||.+...
T Consensus        75 v~~i~~hp~y~~~~~~~DiALl~L~~~~~--------------~~~~v~pic-Lp~~~--~~~~~~~~~~v~GwG~~~~~  137 (235)
T 4dgj_A           75 IDEIVINPHYNRRRKDNDIAMMHLEFKVN--------------YTDYIQPIS-LPEEN--QVFPPGRNCSIAGWGTVVYQ  137 (235)
T ss_dssp             EEEEEECTTCBTTTTBTCCEEEEESSCCC--------------CBTTBCCCB-CCCTT--CCCCTTCEEEEEESSBSSTT
T ss_pred             EEEEEECCCCCCCCCCCeEEEEEECCccc--------------cCCcccccC-CCCcc--cCCCCCCEEEEEecccCCCC
Confidence            678999999955   57999999999998              999999999 77554  23457899999999988777


Q ss_pred             CCCCcCceEEEEEeeCcccccccccccCCCCCCCeEEeeecCCCCCCCCCCCCCeeEEEeCCeEEEEEEEEecCCCCCCC
Q psy17330         85 GPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVG  164 (184)
Q Consensus        85 ~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~C~~~~~~~~~~c~~d~G~pl~~~~~~~~~L~Gi~s~~~~c~~~~  164 (184)
                      +..+..|+...+++++.++|++.+.  ...++++|||++......+.|+||+||||++..+++|+|+||+||+..|+..+
T Consensus       138 ~~~~~~L~~~~~~~~~~~~C~~~~~--~~~~~~~~~Ca~~~~~~~~~C~GDsGgPl~~~~~~~~~l~Gi~S~g~~c~~~~  215 (235)
T 4dgj_A          138 GTTADILQEADVPLLSNERCQQQMP--EYNITENMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYECALPN  215 (235)
T ss_dssp             CCBCSBCEEEEEEEECHHHHHHHCT--TSCCCTTEEEECCTTCCCBCCTTCTTCEEEEEETTEEEEEEEEEECSSSSCTT
T ss_pred             CccchhheEeEeeecCHHHhhhhcc--CccCCCCeEeecCCCCCCccCCCCCCCeEEEEECCcEEEEEEEEEcCCCCCCC
Confidence            6678889999999999999998875  23578999999866677789999999999999999999999999999999888


Q ss_pred             CCeEEEeCcchHHHHHhhhC
Q psy17330        165 FPGVYTRVTNYIQWIADNIS  184 (184)
Q Consensus       165 ~p~vft~v~~~~~WI~~~i~  184 (184)
                      .|++||||+.|++||+++|+
T Consensus       216 ~p~vyt~V~~~~~WI~~~i~  235 (235)
T 4dgj_A          216 RPGVYARVSRFTEWIQSFLH  235 (235)
T ss_dssp             CCEEEEEGGGTHHHHHTTCC
T ss_pred             CCEEEeeHHHHHHHHHHHhC
Confidence            89999999999999999885



>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>3syj_A Adhesion and penetration protein autotransporter; bacterial aggregation and biofilm formation, SELF-associatin autotransporter (SAAT); 2.20A {Haemophilus influenzae} Back     alignment and structure
>3h09_A IGA1 protease, immunoglobulin A1 protease; serine protease, beta helix, hydrolase, M protease, secreted, transmembrane, virulence; 1.75A {Haemophilus influenzae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 7e-28
g2pka.1232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 8e-27
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 1e-25
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 4e-25
d1fxya_228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 9e-25
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 1e-24
d1hj8a_222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 3e-24
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 6e-24
d1ao5a_237 b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) 8e-24
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 1e-23
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 2e-23
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 2e-23
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 2e-23
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 3e-23
d1npma_225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 4e-23
d1eaxa_241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 8e-23
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 9e-23
d1hj9a_223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 1e-22
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 2e-22
g1rtf.1260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 4e-22
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 6e-22
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 8e-22
d1sgfa_228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 8e-22
d1tona_235 b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 2e-21
d1rrka1287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 6e-21
d1lo6a_221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 4e-20
g1h8d.1289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 6e-20
d1orfa_232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 1e-19
d2p3ub1233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 1e-19
d1autc_240 b.47.1.2 (C:) Activated protein c (autoprothrombin 1e-19
d1os8a_223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 2e-19
d1gvkb_240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 3e-19
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 1e-18
d1fi8a_227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 1e-18
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 4e-18
d1m9ua_241 b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax 4e-17
d1azza_226 b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd 4e-17
d1gvza_237 b.47.1.2 (A:) Prostate specific antigen (PSA kalli 5e-17
d2bz6h1254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 7e-17
d1bioa_228 b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI 8e-17
d2qy0b1240 b.47.1.2 (B:447-686) Complement C1R protease, cata 9e-17
d1fona_232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 2e-16
d1op0a_234 b.47.1.2 (A:) Venom serine protease {Hundred-pace 3e-16
d3rp2a_224 b.47.1.2 (A:) Chymase II (mast cell proteinase II) 3e-16
d1elta_236 b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI 4e-16
d1q3xa1242 b.47.1.2 (A:445-686) Mannan-binding lectin serine 6e-16
d1eq9a_222 b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re 1e-15
d1elva1259 b.47.1.2 (A:410-668) Complement C1S protease, cata 2e-15
d1t32a1224 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie 5e-15
d1fq3a_227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 2e-14
d1nn6a_224 b.47.1.2 (A:) Chymase (mast cell protease I) {Huma 2e-14
d1fuja_221 b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie 4e-14
d1eufa_224 b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 3e-13
d2hlca_230 b.47.1.2 (A:) HL collagenase {Common cattle grub ( 2e-12
d1arba_263 b.47.1.1 (A:) Achromobacter protease {Achromobacte 5e-12
d2z7fe1218 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) 4e-11
d1a7sa_225 b.47.1.2 (A:) Heparin binding protein, HBP {Human 8e-11
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 4e-10
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 6e-10
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 7e-06
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Eukaryotic proteases
domain: Coagulation factor XI
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  102 bits (254), Expect = 7e-28
 Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 2/97 (2%)

Query: 87  LSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDT 146
           +   L+  +I +V N +C++     G  I   ++CAG   GGKD+C GDSGGPL    + 
Sbjct: 141 IQNTLQKAKIPLVTNEECQK--RYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNE 198

Query: 147 KYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNI 183
            ++++G+ S+G+ CA+   PGVYT V  Y+ WI +  
Sbjct: 199 VWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKT 235


>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 100.0
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 100.0
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 100.0
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 100.0
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 100.0
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 99.98
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.98
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 99.98
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 99.97
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 99.97
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 99.97
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 99.97
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 99.97
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 99.97
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 99.97
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 99.97
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 99.97
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 99.97
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 99.97
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 99.97
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 99.97
d1elva1259 Complement C1S protease, catalytic domain {Human ( 99.97
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.97
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 99.97
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 99.97
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 99.97
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 99.97
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 99.96
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 99.96
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 99.96
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 99.96
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 99.96
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 99.96
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 99.96
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 99.96
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 99.96
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 99.96
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.95
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 99.95
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 99.95
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 99.95
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 99.95
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 99.95
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 99.95
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 99.95
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 99.95
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 99.95
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 99.94
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.5
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 99.48
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.07
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 98.49
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 98.37
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 98.02
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 97.29
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 97.2
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 96.71
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 96.57
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 96.55
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 96.46
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 96.31
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 96.16
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 95.65
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 95.62
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 90.92
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure