Diaphorina citri psyllid: psy17334


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MVSTTVQTILDNLTSPDNWTLAIGAAENASLLNLTNSSFVPKINGFDDGPQFPAYIRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEHISNTQEEEEEEEENEEEEKEEEEEKEEEKEEEEEKEEQKEEEEQKEEQQISRRVADKD
cccHHHHHHHHccccccccHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHcccccccccccccccccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
******QTILDNLTSPDNWTLAIGAAENASLLNLTNSSFVPKINGFDDGPQFPAYIRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEH**********************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSTTVQTILDNLTSPDNWTLAIGAAENASLLNLTNSSFVPKINGFDDGPQFPAYIRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVADKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0008188 [MF]neuropeptide receptor activityprobableGO:0008528, GO:0004930, GO:0030594, GO:0038023, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0007218 [BP]neuropeptide signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0007200 [BP]phospholipase C-activating G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EA3, chain A
Confidence level:confident
Coverage over the Query: 55-135
View the alignment between query and template
View the model in PyMOL