Psyllid ID: psy17334
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 188 | ||||||
| 328714990 | 781 | PREDICTED: hypothetical protein LOC10016 | 0.473 | 0.113 | 0.741 | 3e-32 | |
| 60328183 | 573 | ecdysis triggering hormone receptor subt | 0.515 | 0.169 | 0.670 | 8e-32 | |
| 347968737 | 832 | AGAP002881-PB [Anopheles gambiae str. PE | 0.478 | 0.108 | 0.711 | 1e-31 | |
| 347968739 | 762 | AGAP002881-PA [Anopheles gambiae str. PE | 0.478 | 0.118 | 0.711 | 1e-31 | |
| 60328185 | 558 | ecdysis triggering hormone receptor subt | 0.515 | 0.173 | 0.670 | 1e-31 | |
| 134031934 | 434 | ecdysis triggering hormone receptor isof | 0.531 | 0.230 | 0.663 | 2e-31 | |
| 270014299 | 461 | hypothetical protein TcasGA2_TC012493 [T | 0.531 | 0.216 | 0.663 | 2e-31 | |
| 134031970 | 451 | ecdysis triggering hormone receptor isof | 0.531 | 0.221 | 0.663 | 2e-31 | |
| 288558748 | 541 | ecdysis triggering hormone receptor isof | 0.542 | 0.188 | 0.638 | 7e-31 | |
| 170034662 | 332 | conserved hypothetical protein [Culex qu | 0.446 | 0.253 | 0.761 | 7e-31 |
| >gi|328714990|ref|XP_001944756.2| PREDICTED: hypothetical protein LOC100169111 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 143 bits (360), Expect = 3e-32, Method: Composition-based stats.
Identities = 66/89 (74%), Positives = 74/89 (83%)
Query: 43 INGFDDGPQFPAYIRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIA 102
I DD FP YIRT MV+C IIL +GV+GN+MVP VILKSKDMRNSTNIFLMNLSIA
Sbjct: 41 IQFLDDDLSFPGYIRTTCMVVCVIILGVGVVGNMMVPIVILKSKDMRNSTNIFLMNLSIA 100
Query: 103 DLMVLLVCTPTVLVEVNSKPETWQMGEHI 131
DLMVLL+CTPTV VEVNS+PETW +GE +
Sbjct: 101 DLMVLLICTPTVFVEVNSRPETWVLGEEL 129
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|60328183|gb|AAX19163.1| ecdysis triggering hormone receptor subtype-A [Manduca sexta] | Back alignment and taxonomy information |
|---|
| >gi|347968737|ref|XP_003436278.1| AGAP002881-PB [Anopheles gambiae str. PEST] gi|333467866|gb|EGK96735.1| AGAP002881-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|347968739|ref|XP_312031.5| AGAP002881-PA [Anopheles gambiae str. PEST] gi|333467865|gb|EAA08029.6| AGAP002881-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|60328185|gb|AAX19164.1| ecdysis triggering hormone receptor subtype-B [Manduca sexta] | Back alignment and taxonomy information |
|---|
| >gi|134031934|ref|NP_001076792.1| ecdysis triggering hormone receptor isoform A [Tribolium castaneum] gi|126116542|gb|ABN79653.1| ecdysis triggering hormone receptor isoform A [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270014299|gb|EFA10747.1| hypothetical protein TcasGA2_TC012493 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|134031970|ref|NP_001076793.1| ecdysis triggering hormone receptor isoform B [Tribolium castaneum] gi|126116544|gb|ABN79654.1| ecdysis triggering hormone receptor isoform B [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|288558748|ref|NP_001165737.1| ecdysis triggering hormone receptor isoform B [Bombyx mori] gi|195946982|dbj|BAG68405.1| neuropeptide receptor A6-B [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|170034662|ref|XP_001845192.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167876063|gb|EDS39446.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 188 | ||||||
| FB|FBgn0038874 | 471 | ETHR "ETHR" [Drosophila melano | 0.436 | 0.174 | 0.695 | 5.3e-28 | |
| ZFIN|ZDB-GENE-980526-208 | 375 | npy8br "neuropeptide Y recepto | 0.473 | 0.237 | 0.353 | 3.8e-10 | |
| UNIPROTKB|F1NK50 | 420 | GPR83-L "Uncharacterized prote | 0.468 | 0.209 | 0.357 | 1e-09 | |
| RGD|1560028 | 415 | RGD1560028 "similar to RIKEN c | 0.585 | 0.265 | 0.310 | 1.3e-09 | |
| ZFIN|ZDB-GENE-090327-1 | 365 | ghsrb "growth hormone secretag | 0.409 | 0.210 | 0.358 | 1.6e-09 | |
| ZFIN|ZDB-GENE-060526-286 | 351 | si:dkey-27p18.2 "si:dkey-27p18 | 0.531 | 0.284 | 0.333 | 3.1e-09 | |
| UNIPROTKB|O02835 | 383 | NPY1R "Neuropeptide Y receptor | 0.558 | 0.274 | 0.370 | 3.8e-09 | |
| UNIPROTKB|O02813 | 382 | NPY1R "Neuropeptide Y receptor | 0.510 | 0.251 | 0.373 | 4.8e-09 | |
| MGI|MGI:104963 | 382 | Npy1r "neuropeptide Y receptor | 0.563 | 0.277 | 0.359 | 4.8e-09 | |
| RGD|3198 | 382 | Npy1r "neuropeptide Y receptor | 0.563 | 0.277 | 0.359 | 4.8e-09 |
| FB|FBgn0038874 ETHR "ETHR" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 314 (115.6 bits), Expect = 5.3e-28, P = 5.3e-28
Identities = 57/82 (69%), Positives = 71/82 (86%)
Query: 50 PQFPAYIRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLV 109
PQ P+YIRT +M C +I+ +GV+GN+MVP VI+K+KDMRNSTNIFL NLSIADL+VLLV
Sbjct: 3 PQIPSYIRTTAMFFCIVIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLV 62
Query: 110 CTPTVLVEVNSKPETWQMGEHI 131
CTPTVLVEVN++PETW +G +
Sbjct: 63 CTPTVLVEVNTRPETWVLGHEM 84
|
|
| ZFIN|ZDB-GENE-980526-208 npy8br "neuropeptide Y receptor Y8b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NK50 GPR83-L "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1560028 RGD1560028 "similar to RIKEN cDNA C130060K24 gene" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090327-1 ghsrb "growth hormone secretagogue receptor b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060526-286 si:dkey-27p18.2 "si:dkey-27p18.2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O02835 NPY1R "Neuropeptide Y receptor type 1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O02813 NPY1R "Neuropeptide Y receptor type 1" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:104963 Npy1r "neuropeptide Y receptor Y1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|3198 Npy1r "neuropeptide Y receptor Y1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 188 | |||
| pfam00001 | 251 | pfam00001, 7tm_1, 7 transmembrane receptor (rhodop | 4e-12 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 3e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-06 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-06 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 6e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 8e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 9e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 9e-06 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 1e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 1e-05 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 2e-05 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 2e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 3e-05 | |
| pfam09736 | 141 | pfam09736, Bud13, Pre-mRNA-splicing factor of RES | 3e-05 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 4e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 4e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 5e-05 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 6e-05 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 6e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 6e-05 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 7e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 7e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 8e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-04 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 1e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 1e-04 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 2e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 2e-04 | |
| pfam10324 | 317 | pfam10324, 7TM_GPCR_Srw, Serpentine type 7TM GPCR | 2e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 2e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 2e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 2e-04 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 3e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 3e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 3e-04 | |
| pfam12118 | 261 | pfam12118, SprA-related, SprA-related family | 3e-04 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 3e-04 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 3e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 3e-04 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 4e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 4e-04 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 4e-04 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 4e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 4e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 4e-04 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 4e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 4e-04 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 4e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 5e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 5e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 5e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 5e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 5e-04 | |
| PHA03087 | 335 | PHA03087, PHA03087, G protein-coupled chemokine re | 5e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 6e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 6e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 6e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 6e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 6e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 7e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 7e-04 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 7e-04 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 7e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 8e-04 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 8e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 8e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.001 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.001 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 0.001 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 0.001 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.001 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.001 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.001 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.001 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.001 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 0.001 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.001 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.001 | |
| PHA02638 | 417 | PHA02638, PHA02638, CC chemokine receptor-like pro | 0.001 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.001 | |
| PRK14156 | 177 | PRK14156, PRK14156, heat shock protein GrpE; Provi | 0.001 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 0.001 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 0.001 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 0.001 | |
| pfam11831 | 363 | pfam11831, Myb_Cef, pre-mRNA splicing factor compo | 0.001 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 0.001 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 0.002 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 0.002 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 0.002 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.002 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.002 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.002 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 0.002 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.002 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.002 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 0.002 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.002 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.002 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 0.002 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 0.002 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.002 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.002 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 0.002 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 0.002 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 0.003 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 0.003 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.003 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.003 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 0.003 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.003 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.003 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.003 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 0.003 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.003 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 0.003 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.003 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.003 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 0.003 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 0.003 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 0.003 | |
| pfam10328 | 275 | pfam10328, 7TM_GPCR_Srx, Serpentine type 7TM GPCR | 0.003 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.003 | |
| COG1293 | 564 | COG1293, COG1293, Predicted RNA-binding protein ho | 0.003 | |
| cd08045 | 212 | cd08045, TAF4, TATA Binding Protein (TBP) Associat | 0.003 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 0.003 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.004 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.004 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 0.004 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.004 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.004 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.004 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.004 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.004 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.004 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 0.004 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.004 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 0.004 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 0.004 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.004 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 0.004 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 0.004 | |
| pfam10320 | 257 | pfam10320, 7TM_GPCR_Srsx, Serpentine type 7TM GPCR | 0.004 | |
| smart00786 | 196 | smart00786, SHR3_chaperone, ER membrane protein SH | 0.004 |
| >gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) | Back alignment and domain information |
|---|
Score = 62.3 bits (152), Expect = 4e-12
Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)
Query: 80 CVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEH 130
VIL++K +R TNIFL+NL++ADL+ LL P L W G+
Sbjct: 1 LVILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWAL--YYLVGGDWPFGDA 49
|
This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251 |
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|220692 pfam10324, 7TM_GPCR_Srw, Serpentine type 7TM GPCR chemoreceptor Srw | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|221429 pfam12118, SprA-related, SprA-related family | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|222976 PHA03087, PHA03087, G protein-coupled chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|165021 PHA02638, PHA02638, CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|237628 PRK14156, PRK14156, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|220695 pfam10328, 7TM_GPCR_Srx, Serpentine type 7TM GPCR chemoreceptor Srx | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|173965 cd08045, TAF4, TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|192535 pfam10320, 7TM_GPCR_Srsx, Serpentine type 7TM GPCR chemoreceptor Srsx | Back alignment and domain information |
|---|
| >gnl|CDD|129022 smart00786, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 188 | |||
| KOG4219|consensus | 423 | 99.48 | ||
| KOG4220|consensus | 503 | 99.27 | ||
| PHA03234 | 338 | DNA packaging protein UL33; Provisional | 99.24 | |
| PHA02834 | 323 | chemokine receptor-like protein; Provisional | 98.94 | |
| PHA02638 | 417 | CC chemokine receptor-like protein; Provisional | 98.86 | |
| PHA03235 | 409 | DNA packaging protein UL33; Provisional | 98.81 | |
| PHA03087 | 335 | G protein-coupled chemokine receptor-like protein; | 98.78 | |
| PF00001 | 257 | 7tm_1: 7 transmembrane receptor (rhodopsin family) | 98.17 | |
| PF10320 | 257 | 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep | 97.53 | |
| KOG2087|consensus | 363 | 96.44 | ||
| PF10324 | 318 | 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept | 93.82 | |
| PF11710 | 201 | Git3: G protein-coupled glucose receptor regulatin | 92.97 | |
| PF05462 | 303 | Dicty_CAR: Slime mold cyclic AMP receptor | 92.57 | |
| PF05296 | 303 | TAS2R: Mammalian taste receptor protein (TAS2R); I | 92.06 | |
| PF10328 | 274 | 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept | 91.69 | |
| PF10317 | 292 | 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept | 87.84 | |
| KOG2927|consensus | 372 | 84.96 | ||
| PF03344 | 713 | Daxx: Daxx Family; InterPro: IPR005012 Daxx is a u | 84.04 | |
| PF10321 | 313 | 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept | 82.62 |
| >KOG4219|consensus | Back alignment and domain information |
|---|
Probab=99.48 E-value=2.1e-14 Score=122.64 Aligned_cols=86 Identities=26% Similarity=0.402 Sum_probs=77.1
Q ss_pred CCCCCccchhhHHHHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCccccc
Q psy17334 49 GPQFPAYIRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMG 128 (188)
Q Consensus 49 ~~~~~~~~~~~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg 128 (188)
....|.+.+.++.++|+++++++++||++|||++..+|++|+.+|+|++|||+||+++++++.++...+. ....|.||
T Consensus 27 ~f~lp~~~~~~wai~yg~l~~vAv~GN~iVlwIil~hrrMRtvtnyfL~NLAfADl~~s~Fn~~f~f~ya--l~~~W~~G 104 (423)
T KOG4219|consen 27 LFVLPAWQQALWAIAYGLLVFVAVVGNLIVLWIILAHRRMRTVTNYFLVNLAFADLSMSIFNTVFNFQYA--LHQEWYFG 104 (423)
T ss_pred cccCCHHHHHHHHHHHHHHHHHHHhcCceEEEEEeehhehhhhHHHHHHHHHHHHHHHHHHhhHHHHHHH--HHhccccc
Confidence 3456677888899999999999999999999999999999999999999999999999999999877644 44889999
Q ss_pred cccccccc
Q psy17334 129 EHISNTQE 136 (188)
Q Consensus 129 ~~~Cki~~ 136 (188)
.++|++..
T Consensus 105 ~f~C~f~n 112 (423)
T KOG4219|consen 105 SFYCRFVN 112 (423)
T ss_pred cceeeecc
Confidence 99999864
|
|
| >KOG4220|consensus | Back alignment and domain information |
|---|
| >PHA03234 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PHA02834 chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02638 CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03235 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PHA03087 G protein-coupled chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG2087|consensus | Back alignment and domain information |
|---|
| >PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor | Back alignment and domain information |
|---|
| >PF05462 Dicty_CAR: Slime mold cyclic AMP receptor | Back alignment and domain information |
|---|
| >PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) | Back alignment and domain information |
|---|
| >PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG2927|consensus | Back alignment and domain information |
|---|
| >PF03344 Daxx: Daxx Family; InterPro: IPR005012 Daxx is a ubiquitously expressed protein that functions, in part, as a transcriptional co-repressor through its interaction with a growing number of nuclear, DNA-associated proteins | Back alignment and domain information |
|---|
| >PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 188 | ||||
| 4dkl_A | 464 | Crystal Structure Of The Mu-Opioid Receptor Bound T | 4e-05 | ||
| 4djh_A | 480 | Structure Of The Human Kappa Opioid Receptor In Com | 8e-05 | ||
| 4ea3_B | 434 | Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WI | 1e-04 | ||
| 4ej4_A | 461 | Structure Of The Delta Opioid Receptor Bound To Nal | 8e-04 |
| >pdb|4DKL|A Chain A, Crystal Structure Of The Mu-Opioid Receptor Bound To A Morphinan Antagonist Length = 464 | Back alignment and structure |
|
| >pdb|4DJH|A Chain A, Structure Of The Human Kappa Opioid Receptor In Complex With Jdtic Length = 480 | Back alignment and structure |
| >pdb|4EA3|B Chain B, Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WITH A PEPTIDE Mimetic Length = 434 | Back alignment and structure |
| >pdb|4EJ4|A Chain A, Structure Of The Delta Opioid Receptor Bound To Naltrindole Length = 461 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 188 | |||
| 4grv_A | 510 | Neurotensin receptor type 1, lysozyme chimera; G-p | 99.43 | |
| 2ks9_A | 364 | Substance-P receptor; water, autodock, NK1, neurop | 99.27 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 99.26 | |
| 2lnl_A | 296 | C-X-C chemokine receptor type 1; G protein coupled | 99.24 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 99.24 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 99.21 | |
| 1u19_A | 349 | Rhodopsin; G protein-coupled receptor, membrane pr | 99.21 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 99.18 | |
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 99.16 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 99.14 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 99.14 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 99.12 | |
| 3vw7_A | 484 | Proteinase-activated receptor 1, lysozyme; high re | 99.12 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 99.1 | |
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 99.07 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 99.07 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 99.04 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 99.04 | |
| 2lot_A | 64 | Apelin receptor; membrane protein; NMR {Homo sapie | 96.71 |
| >4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=99.43 E-value=1.1e-14 Score=128.10 Aligned_cols=82 Identities=18% Similarity=0.380 Sum_probs=68.9
Q ss_pred cchhhHHHHHHHHHHHHhhcccceeeEeeecCcC---CCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCcccccccc
Q psy17334 55 YIRTPSMVLCSIILCIGVLGNIMVPCVILKSKDM---RNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEHI 131 (188)
Q Consensus 55 ~~~~~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l---~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg~~~ 131 (188)
+.++++.++|++++++|++||++||+++.+.|++ |+++|+|++|||++|++++++++|+.++.+....+.|+||..+
T Consensus 30 ~~~v~~~~~~~~i~~~g~~gN~lvi~~i~~~~~~r~~~~~~n~~i~~La~aDll~~~~~~p~~~~~~~~~~~~w~~g~~~ 109 (510)
T 4grv_A 30 YSKVLVTAIYLALFVVGTVGNSVTLFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAG 109 (510)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHTSCC----CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSCSSHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHhhhheeeecCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEhhHHH
Confidence 4566788899999999999999999998887654 4788999999999999999999998887666566889999999
Q ss_pred ccccc
Q psy17334 132 SNTQE 136 (188)
Q Consensus 132 Cki~~ 136 (188)
|++..
T Consensus 110 C~~~~ 114 (510)
T 4grv_A 110 CRGYY 114 (510)
T ss_dssp HHHHH
T ss_pred HHHHH
Confidence 99753
|
| >2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* | Back alignment and structure |
|---|
| >2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* | Back alignment and structure |
|---|
| >3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* | Back alignment and structure |
|---|
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* | Back alignment and structure |
|---|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* | Back alignment and structure |
|---|
| >2lot_A Apelin receptor; membrane protein; NMR {Homo sapiens} PDB: 2lou_A 2lov_A 2low_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 188 | ||||
| d1u19a_ | 348 | f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: | 1e-18 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Score = 79.6 bits (195), Expect = 1e-18
Identities = 17/86 (19%), Positives = 38/86 (44%), Gaps = 5/86 (5%)
Query: 32 LNLTNSSFVPKINGFDDGPQF---PAYIRTPSMVLCSIILCIGVLGNIMVPCVILKSKDM 88
+ +N + V + + PQ+ + + +++ +G N + V ++ K +
Sbjct: 11 VPFSNKTGV--VRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKL 68
Query: 89 RNSTNIFLMNLSIADLMVLLVCTPTV 114
R N L+NL++ADL ++ T
Sbjct: 69 RTPLNYILLNLAVADLFMVFGGFTTT 94
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 188 | |||
| d1u19a_ | 348 | Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | 99.17 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.17 E-value=1.3e-12 Score=105.78 Aligned_cols=82 Identities=20% Similarity=0.254 Sum_probs=68.6
Q ss_pred CCccchhhHHHHHHHHHHHHhhcccceeeEeeecCcCCCcchhHhHHhHHHHHhhhhhccceeeEEeccCCCcccccccc
Q psy17334 52 FPAYIRTPSMVLCSIILCIGVLGNIMVPCVILKSKDMRNSTNIFLMNLSIADLMVLLVCTPTVLVEVNSKPETWQMGEHI 131 (188)
Q Consensus 52 ~~~~~~~~~~~~~~~i~l~gl~GN~lvi~~i~~~~~l~~~~~~fi~nLa~aDLl~~l~~~P~~i~~~~~~~~~W~fg~~~ 131 (188)
.+.+...++++++.+++++|++||+++++++.++|++|++.|++++|||++|++.++...|..+... ..+.|.++...
T Consensus 32 ~~~~~~~~~~~~~~ii~v~gi~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~~~~~~~~~~--~~~~~~~~~~~ 109 (348)
T d1u19a_ 32 AEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTS--LHGYFVFGPTG 109 (348)
T ss_dssp SCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHTHHHHHHHH--HHTSCTTHHHH
T ss_pred ccHHHHHHHHHHHHHHHHHHHHHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHHHHHHhhhhh--ccCccccCchh
Confidence 3344556778888889999999999999999999999999999999999999999988888776533 33678888888
Q ss_pred cccc
Q psy17334 132 SNTQ 135 (188)
Q Consensus 132 Cki~ 135 (188)
|++.
T Consensus 110 c~~~ 113 (348)
T d1u19a_ 110 CNLE 113 (348)
T ss_dssp HHHH
T ss_pred hhhh
Confidence 8764
|