Diaphorina citri psyllid: psy17340

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MPPIGICRISSIVEKVDLVETYLRVCPLHKSSGDVPQGLFPAQEQSYLPKVLTYDEAEDEDNSLINIDGFTTSKLPPGILPHGLPQVKDVKPAITSLEHTEIKKEETKPTSKLPPGILPHGLPQVKDVKPAITSLEHTEIKKEETKPIVELSEDEKLKITLSEEFQHFVARTGRVMERLLAEKSDMYKDYMGLGDADEIG
cccccEEEEEEEEEccccHHHHHcccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccEEcccccccccccc
*PPIGICRISSIVEKVDLVETYLRVCPLHKSSGDVPQGLFPA**QSYLPKVLTYD*******SLINIDGFTTSKLPPGILP************************************************************************DEKLKITLSEEFQHFVARTGRVMERLLAEKSDMYKDY**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPIGICRISSIVEKVDLVETYLRVCPLHKSSGDVPQGLFPAQEQSYLPKVLTYDEAEDEDNSLINIDGFTTSKLPPGILPHGLPQVKDVKPAITSLEHTEIKKEETKPTSKLPPGILPHGLPQVKDVKPAITSLEHTEIKKEETKPIVELSEDEKLKITLSEEFQHFVARTGRVMERLLAEKSDMYKDYMGLGDADEIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L9K, chain W
Confidence level:very confident
Coverage over the Query: 151-188
View the alignment between query and template
View the model in PyMOL
Template: 2PG1, chain I
Confidence level:probable
Coverage over the Query: 29-54
View the alignment between query and template
View the model in PyMOL