Diaphorina citri psyllid: psy17341

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--

MGDKDQRKELDSMLSSLGVAPVADVMSSLSSVSANGTPESNNTPDTSILNSYHSAAYLVVELSEDEKLKITLSEEFQHFVARTGRVMERLLAEKSDMYKDYMGLGDADEIGDEKSSTKLSFCRQFFDEKWSKNQQMAPKDGDEKSSTKLSFCRQFFDEKWSKNRNVTYMDWSTQHPELLLASYHRNKEAPNEPDGVCLIWNTKFKKTTPEFEFFCQSPVLSCCFAKFFFLYA

cccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccEEEECccccccccEEEEcccccccccccccEEEEEEcccccccccEEEEccccEEEEEEcccccccc

*******************************************************AYLVVELSEDEKLKITLSEEFQHFVARTGRVMERLLAEKSDMYKDYMGLGDAD**********LSFCRQFFD*********************LSFCRQFFDEKWSKNRNVTYMDWSTQHPELLLASYHRNKEAPNEPDGVCLIWNTKFKKTTPEFEFFCQSPVLSCCFAKFFFLY*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000922 [CC]	spindle pole	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003777 [MF]	microtubule motor activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0031982 [CC]	vesicle	probable	GO:0005575, GO:0043226
GO:0047496 [BP]	vesicle transport along microtubule	probable	GO:0051234, GO:0007017, GO:0046907, GO:0007018, GO:0006810, GO:0072384, GO:0030705, GO:0044765, GO:0010970, GO:0044763, GO:0044699, GO:0051648, GO:0051649, GO:0008150, GO:0009987, GO:0006928, GO:0051179, GO:0051640, GO:0051641
GO:0005868 [CC]	cytoplasmic dynein complex	probable	GO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0043226, GO:0044424, GO:0030286, GO:0043228, GO:0005875, GO:0044422
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0000776 [CC]	kinetochore	probable	GO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L9K, chain W
Confidence level:very confident
Coverage over the Query: 62-99
View the alignment between query and template
View the model in PyMOL

Template: 3GRE, chain A
Confidence level:probable
Coverage over the Query: 163-231
View the alignment between query and template
View the model in PyMOL