Diaphorina citri psyllid: psy17351

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--

MRKVREVRTQLKEILIQQKMKLVSCGTDWDVIRKCICSALFGMGFTPDYVVYHELIMTSKEYMQCVTAVDGQWLAELGPMFFSVKETGKSGSTKRRKALEHLHEMEDQMKQAQDEIQARKEEEERRQAQVSSRVGEILTPGLKETAPGTPYTPRRTPKRFGL

cccHHHHHHHHHHHHHHcccccEEcccccHHHHHHHHcccccccccccEEEEEEEEcccccccccccECcccHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEccccccccccccccccccccccccc

MRKVREVRTQLKEILIQQKMKLVSCGTDWDVIRKCICSALFGMGFTPDYVVYHELIMTSKEYMQCVTAVDGQWLAELGPMFFSV******************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRKVREVRTQLKEILIQQKMKLVSCGTDWDVIRKCICSALFGMGFTPDYVVYHELIMTSKEYMQCVTAVDGQWLAELGPMFFSVKETGKSGSTKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVSSRVGEILTPGLKETAPGTPYTPRRTPKRFGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16	Probable ATP-binding RNA helicase involved in pre-mRNA splicing.	confident	Q92620
Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16	Probable ATP-binding RNA helicase involved in pre-mRNA splicing.	confident	Q17R09

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0003674 [MF]	molecular_function	probable
GO:0009987 [BP]	cellular process	probable	GO:0008150
GO:0031981 [CC]	nuclear lumen	probable	GO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I4U, chain A
Confidence level:very confident
Coverage over the Query: 1-86
View the alignment between query and template
View the model in PyMOL