Diaphorina citri psyllid: psy17361

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22

MKKRTLTAKKKKIRFAGIKRNLQRTYASWSQTKLNSTDQGRALFTLAWFHALIQERRTYIPQGWAKFYEFNDSDLNAALNILNARLSQDGMGGVKWDYIHGLLGNAIYGGRIDNAQDMKVLSSYLQFYFSSNVAKTASTPLAPGVVLPSSTNLGTPDDWQSIWSGSGNPLLYIRSVVSRAVTVHKCYQVSSTYWRSPVDLSGLFHPHAFLSVLKQHTAR

cccccHHHHHccccHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccHHHHcccccccccccccccccccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcc

*KKRTLTAKKKKIRFAGIKRNLQRTYASWSQTKLNSTDQGRALFTLAWFHALIQERRTYIPQGWAKFYEFNDSDLNAALNILNARLSQDGMGGVKWDYIHGLLGNAIYGGRIDNAQDMKVLSSYLQFYFSSNVAKTASTPLAPGVVLPSSTNLGTPDDWQSIWSGSGNPLLYIRSVVSRAVTVHKCYQVSSTYWRSPVDLSGLFHPHAFLSVLKQH***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytoplasmic dynein 2 heavy chain 1	May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis. May play a role in transport between endoplasmic reticulum and Golgi or organization of the Golgi in cells.	confident	Q9JJ79
Cytoplasmic dynein 2 heavy chain 1	May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis. According to PubMed:8666668, it may play a role in transport between endoplasmic reticulum and Golgi or organization of the Golgi in cells.	confident	Q45VK7
Cytoplasmic dynein 2 heavy chain 1	May function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis. May play a role in transport between endoplasmic reticulum and Golgi or organization of the Golgi in cells.	confident	Q8NCM8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031512 [CC]	motile primary cilium	probable	GO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0005874 [CC]	microtubule	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0045177 [CC]	apical part of cell	probable	GO:0005575, GO:0044464, GO:0005623
GO:0044767 [BP]	single-organism developmental process	probable	GO:0032502, GO:0008150, GO:0044699
GO:0033036 [BP]	macromolecule localization	probable	GO:0008150, GO:0051179
GO:0007030 [BP]	Golgi organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0005938 [CC]	cell cortex	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0030154 [BP]	cell differentiation	probable	GO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035085 [CC]	cilium axoneme	probable	GO:0005737, GO:0005575, GO:0044463, GO:0043231, GO:0032838, GO:0031514, GO:0044441, GO:0044464, GO:0043229, GO:0005623, GO:0043226, GO:0044446, GO:0044444, GO:0097014, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622
GO:0009653 [BP]	anatomical structure morphogenesis	probable	GO:0032502, GO:0048856, GO:0008150

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3vkg, chain A		very confident	Alignment \| Template Structure