Diaphorina citri psyllid: psy17363

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790

MEDTEEYYNEILNYPKSVQDALKEIMPSTDVLDDHDFDSVQYINSLFPTEQSLSNIDDVIMKMESNIKEMDEEIETVVRSQSGVGQDGKKALEDSQKVIMQLFSQVRDIKSKAEKSEEMVREITRDIKLLDTAKRNLTTAITCLNHLHMLVTGVHSLRTLIEQRQYGEIVMPLQGVIEVMKHFQDSTDIPQILELRSQVAQIQNTLSEQITQDLKNAFQNPSSGSFVPSKQIAEALRVVSILDPKVKKNILEWFISLQLSEYLVLFDESEDSAWLDKIDKRYAWFKKQLLHVEDKFGTLFPPHWQLSEKITLEFCERTRSELGKIMSKRKFEIDVKLLLYAIQKTSNFEQLLEKRFADDETEGENKTKFDGIIGSCFQNYLYIYIESLDRNLSDLIDRFAEDSKQVLNNINETCETSAAPVLPSCADLFMFYKKSLVQCTQLSTGEPMVALATTFQQYLRHYAHKVLQQNVSKQAGQTANTTLASVSNITRDLGLIKDQRTKYTPQEQAKICCVLTTAEYCLETTQQLEQKLKEKVDPNLANKIDLSNEQDVFHNVISSCIQLLVQDLELACEPALTAMVKTNWSSVESVGDQSGYVTAITSHLKQSVPLIRTNLSSSRKYFTQFCVKFANSFIPKLVQHVFKCKPLSTVGAEQLLLDIHMLKTVLLDLPSIGSQVVRKAPASFTKVVVKGMTKAEMILKLVMASAEPDICFVEQFCKLLPESDMTEFQRILDMKGLKTNEKNNLINLFRPKNPSNTSSSLVAATNSTSSSRQDTSSIQKLNNLIKKNLM

cccHHHHHHHcccccHHHHHHHHHHcccccccccccccHHHHHHHHccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHcHHHHHcccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHccccccccccccHcccccccccccccHHHHHHHHHHHHHcc

******YYNEILNYPKSVQDALKEIMPSTDVLDDHDFDSVQYINSLFPTEQSLSNIDDVIMKMESN********************************IMQLFSQVR**************EITRDIKLLDTAKRNLTTAITCLNHLHMLVTGVHSLRTLIEQRQYGEIVMPLQGVIEVMKHFQDSTDIPQILELRSQVAQIQNTLSEQITQDLKNA*************QIAEALRVVSILDPKVKKNILEWFISLQLSEYLVLFDESEDSAWLDKIDKRYAWFKKQLLHVEDKFGTLFPPHWQLSEKITLEFCERTRSELGKIMSKRKFEIDVKLLLYAIQKTSNFEQLLEKRF*********KTKFDGIIGSCFQNYLYIYIESLDRNLSDLIDRFAEDSK***************PVLPSCADLFMFYKKSLVQCTQLSTGEPMVALATTFQQYLRHYAHKVLQQNVS***************************RTKYTPQEQAKICCVLTTAEYCLETTQQLEQKLKEKV**NLANKIDLSNEQDVFHNVISSCIQLLVQDLELACEPALTAMVKTNWSSVESVGDQSGYVTAITSHLKQSVPLIRTNLSSSRKYFTQFCVKFANSFIPKLVQHVFKCKPLSTVGAEQLLLDIHMLKTVLLDLPSIGS*VVRKAPASFTKVVVKGMTKAEMILKLVMASAEPDICFVEQFCKLLPESDMTEFQRILDMKGLKTNEKNNLINLF**********************************LIKKNLM

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEDTEEYYNEILNYPKSVQDALKEIMPSTDVLDDHDFDSVQYINSLFPTEQSxxxxxxxxxxxxxxxxxxxxxxxxxxxxQSGVGQDGKKALEDSQKVIMQLFSQxxxxxxxxxxxxxxxxxxxxxIKLLDTAKRNLTTAITCLNHLHMLVTGVHSLRTLIEQRQYGEIVMPLQGVIEVMKHFQDSTDIPQILELRSQVAQIQNTLSEQITQDLKNAFQNPSSGSFVPSKQIAEALRVVSILDPKVKKNILEWFISLQLSEYLVLFDESEDSAWLDKIDKRYAWFKKQLLHVEDKFGTLFPPHWQLSEKITLEFCERTRSELGKIMSKRKFEIDVKLLLYAIQKTSNFEQLLEKRFADDETEGENKTKFDGIIGSCFQNYLYIYIESLDRNLSDLIDRFAEDSKQVLNNINETCETSAAPVLPSCADLFMFYKKSLVQCTQLSTGEPMVALATTFQQYLRHYAHKVLQQNVSKQAGQTANTTLASVSNITRDLGLIKDQRTKYTPQEQAKICCVLTTAEYCLETTQQLEQKLKEKVDPNLANKIDLSNEQDVFHNVISSCIQLLVQDLELACEPALTAMVKTNWSSVESVGDQSGYVTAITSHLKQSVPLIRTNLSSSRKYFTQFCVKFANSFIPKLVQHVFKCKPLSTVGAEQLLLDIHMLKTVLLDLPSIGSQVVRKAPASFTKVVVKGMTKAEMILKLVMASAEPDICFVEQFCKLLPESDMTEFQRILDMKGLKTNEKNNLINLFRPKNPSNTSSSLVAATNSTSSSRQDTSSIQKLNNLIKKNLM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vacuolar protein sorting-associated protein 53 homolog	May be involved in retrograde transport from early and late endosomes to the late Golgi. The GARP complex is required for the maintenance of the cycling of mannose 6-phosphate receptors between the TGN and endosomes, this cycling is necessary for proper lysosomal sorting of acid hydrolases such as CTSD.	very confident	Q8CCB4
Vacuolar protein sorting-associated protein 53 homolog	May be involved in retrograde transport of early and late endosomes to the late Golgi.	very confident	Q5ZLD7
Vacuolar protein sorting-associated protein 53 homolog	May be involved in retrograde transport from early and late endosomes to the late Golgi. The GARP complex is required for the maintenance of the cycling of mannose 6-phosphate receptors between the TGN and endosomes, this cycling is necessary for proper lysosomal sorting of acid hydrolases such as CTSD.	confident	Q5R5J4

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000938 [CC]	GARP complex	probable	GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031982, GO:0016023, GO:0031410, GO:0031988, GO:0044433, GO:0044431, GO:0005794, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0060378 [BP]	regulation of brood size	probable	GO:0032501, GO:0048609, GO:0032504, GO:0044706, GO:0022414, GO:0065007, GO:0008150, GO:0065008, GO:0000003, GO:0051704
GO:0042147 [BP]	retrograde transport, endosome to Golgi	probable	GO:0016197, GO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0040015 [BP]	negative regulation of multicellular organism growth	probable	GO:0045926, GO:0040014, GO:0040008, GO:0051241, GO:0008150, GO:0065007, GO:0051239, GO:0048519, GO:0050789

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FHN, chain A
Confidence level:confident
Coverage over the Query: 51-473,485-671,683-744
View the alignment between query and template
View the model in PyMOL

Template: 3NS4, chain A
Confidence level:confident
Coverage over the Query: 618-754
View the alignment between query and template
View the model in PyMOL

Template: 2FJI, chain 1
Confidence level:confident
Coverage over the Query: 371-749
View the alignment between query and template
View the model in PyMOL