Diaphorina citri psyllid: psy17364

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--

MLHSKSSFLARFFHASANQLTTNKSLLGKLRKKTGYSFTNCKKALDLNEQDLGKAEKWLQEQAKELGWAKASKLAGRKTSQGLISIAVEGKHATMVEFNCETDFVARNKQFQGMAELISLACLNYTKTQVQPQEPFAKVFLDTAQLQSLAGPENKSLADHVAILISSVGENLVLRRAACVTVNEDHDVAGFTHPSPGLEHTGPILGKFGSLMVYQDLKTGDKQQNVQNVARQLCQHVIGMNPKSIGSEEDTPNEDPEEETIMYHQEFLLDPTQYVGEVIVAAGIKPVEFLRFECGEGCEESEETQTQAATAG

cccccHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHccccccEEEEEEEcccEEEEEEEccccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHccHHHHHcccccccccHHHHHHHHHHHHccccccEEEEEEECccccEEEEEEcccccccccccccccEEEEEEEECccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHcccEEEEEEEEEEccccccccccHHHHHHcc

*******FLARFFHASANQLTTNKSLLGKLRKKTGYSFTNCKKALDLNEQDLGKAEKWLQEQAKELGWAKASKLAGRKTSQGLISIAVEGKHATMVEFNCETDFVARNKQFQGMAELISLACLNYTKTQVQPQEPFAKVFLDTAQLQSLA*PENKSLADHVAILISSVGENLVLRRAACVTVNEDHDVAGFTHPSPGLEHTGPILGKFGSLMVYQDLKTGDKQQNVQNVARQLCQHVIGMNPKS***********PEEETIMYHQEFLLDPTQYVGEVIVAAGIKPVEFLRFECGEGCEE************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Elongation factor Ts	Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.	confident	C3MBQ3
Elongation factor Ts, mitochondrial	Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.	confident	Q20819
Elongation factor Ts	Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.	confident	A8GM33

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032784 [BP]	regulation of DNA-dependent transcription, elongation	probable	GO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0003746 [MF]	translation elongation factor activity	probable	GO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0006414 [BP]	translational elongation	probable	GO:0071704, GO:0044267, GO:0044238, GO:0008152, GO:0044260, GO:1901576, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:0006412

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AIP, chain C
Confidence level:very confident
Coverage over the Query: 23-183
View the alignment between query and template
View the model in PyMOL

Template: 1XB2, chain B
Confidence level:very confident
Coverage over the Query: 21-294
View the alignment between query and template
View the model in PyMOL