Diaphorina citri psyllid: psy17370

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--

MSTKSNPRALFSSTPVKKNEGPIATLSSSNQSKPKEKFVKPATPKTPLATANYERCIQARRAMSADRSPATPKIKLPRANLIMRSSSENCVADNLECSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRFESKPSHEIYLSVSVLTDITKFIEVY

ccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHccccHHccccccccccEEEEEccccccHHHccccccEEEcccccEEEEccccccCEEEccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEccccccccEEccccccccccHHHHHHHHHHHccccccCEEEEEEEEEEEEEEcccccccccccccccccccEEccccccEEEc

*************************************************************************************************SRMTVAVRIRPLLVKELHMDVSSIE*************AKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRFESKPSHEIYLSVSVLTDITKFIEVY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008569 [MF]	minus-end-directed microtubule motor activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774, GO:0003777
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0005819 [CC]	spindle	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005881 [CC]	cytoplasmic microtubule	probable	GO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U06, chain A
Confidence level:very confident
Coverage over the Query: 82-262
View the alignment between query and template
View the model in PyMOL