Psyllid ID: psy17370
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 262 | ||||||
| 189237405 | 619 | PREDICTED: similar to kinesin-like prote | 0.541 | 0.229 | 0.371 | 5e-15 | |
| 270008161 | 704 | nebbish [Tribolium castaneum] | 0.541 | 0.201 | 0.371 | 5e-15 | |
| 383862963 | 1199 | PREDICTED: kinesin-like protein KIF14-li | 0.679 | 0.148 | 0.315 | 1e-13 | |
| 322798327 | 525 | hypothetical protein SINV_08845 [Solenop | 0.354 | 0.177 | 0.445 | 4e-13 | |
| 170043367 | 533 | kinesin-II 85 kDa subunit [Culex quinque | 0.351 | 0.172 | 0.439 | 4e-13 | |
| 149058501 | 639 | kinesin family member 14 (predicted) [Ra | 0.435 | 0.178 | 0.366 | 5e-13 | |
| 332024101 | 529 | Kinesin-like protein KIF14 [Acromyrmex e | 0.354 | 0.175 | 0.435 | 6e-13 | |
| 157125836 | 1151 | kinesin-like protein KIF1B [Aedes aegypt | 0.354 | 0.080 | 0.405 | 7e-13 | |
| 189233731 | 619 | PREDICTED: similar to AGAP002427-PA [Tri | 0.484 | 0.205 | 0.337 | 1e-12 | |
| 291402681 | 1633 | PREDICTED: kinesin family member 14 [Ory | 0.408 | 0.065 | 0.408 | 1e-12 |
| >gi|189237405|ref|XP_973631.2| PREDICTED: similar to kinesin-like protein KIF1B [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 87.4 bits (215), Expect = 5e-15, Method: Compositional matrix adjust.
Identities = 62/167 (37%), Positives = 87/167 (52%), Gaps = 25/167 (14%)
Query: 36 EKFVKPATPKTPLATANYERCIQARRAMSADRSPATPKIKLPRANLIMRSSSENCVADNL 95
E FV P TP+ LAT ++ RA + +T ++ P + L RSS E
Sbjct: 32 EGFVAPTTPRN-LATP------KSNRAANTPECFSTVTLETPNSALKRRSSKEKFD---- 80
Query: 96 ECSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDN-------AKSYTFKLDH--- 145
S +TVAVRIRP+ +EL ++ + +E+ + N + + F+ DH
Sbjct: 81 RVSNLTVAVRIRPMNSRELACVGAANVVKVRNQELVIRSNPLGNSAMSLDHVFQYDHIFW 140
Query: 146 -CLGQDT---DQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSY 188
C D+ Q VFT + QPLL++AF GYN CLFAYGQTGSGKS+
Sbjct: 141 SCDESDSLYSSQEDVFTTVGQPLLNSAFRGYNACLFAYGQTGSGKSF 187
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270008161|gb|EFA04609.1| nebbish [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383862963|ref|XP_003706952.1| PREDICTED: kinesin-like protein KIF14-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|322798327|gb|EFZ20067.1| hypothetical protein SINV_08845 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|170043367|ref|XP_001849362.1| kinesin-II 85 kDa subunit [Culex quinquefasciatus] gi|167866727|gb|EDS30110.1| kinesin-II 85 kDa subunit [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|149058501|gb|EDM09658.1| kinesin family member 14 (predicted) [Rattus norvegicus] | Back alignment and taxonomy information |
|---|
| >gi|332024101|gb|EGI64317.1| Kinesin-like protein KIF14 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|157125836|ref|XP_001660806.1| kinesin-like protein KIF1B [Aedes aegypti] gi|108882659|gb|EAT46884.1| AAEL001986-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|189233731|ref|XP_971025.2| PREDICTED: similar to AGAP002427-PA [Tribolium castaneum] gi|270015046|gb|EFA11494.1| hypothetical protein TcasGA2_TC014207 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|291402681|ref|XP_002717707.1| PREDICTED: kinesin family member 14 [Oryctolagus cuniculus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 262 | ||||||
| MGI|MGI:1098239 | 1348 | Kif7 "kinesin family member 7" | 0.351 | 0.068 | 0.432 | 7.1e-13 | |
| UNIPROTKB|F8WD21 | 147 | KIF7 "Kinesin-like protein KIF | 0.343 | 0.612 | 0.4 | 9.1e-13 | |
| RGD|1310650 | 639 | Kif14 "kinesin family member 1 | 0.358 | 0.147 | 0.441 | 1.5e-12 | |
| UNIPROTKB|Q15058 | 1648 | KIF14 "Kinesin-like protein KI | 0.587 | 0.093 | 0.341 | 2.6e-12 | |
| RGD|1310310 | 1341 | Kif7 "kinesin family member 7" | 0.351 | 0.068 | 0.422 | 2.9e-12 | |
| UNIPROTKB|F2Z355 | 171 | KIF27 "Kinesin-like protein KI | 0.320 | 0.491 | 0.409 | 4.8e-12 | |
| UNIPROTKB|J9PAQ6 | 540 | KIF14 "Uncharacterized protein | 0.358 | 0.174 | 0.431 | 6.9e-12 | |
| UNIPROTKB|J9NT06 | 596 | KIF7 "Uncharacterized protein" | 0.351 | 0.154 | 0.412 | 1.6e-11 | |
| UNIPROTKB|E2R054 | 1646 | KIF14 "Uncharacterized protein | 0.358 | 0.057 | 0.431 | 3.3e-11 | |
| UNIPROTKB|F1PD49 | 1355 | KIF7 "Uncharacterized protein" | 0.351 | 0.067 | 0.412 | 5e-11 |
| MGI|MGI:1098239 Kif7 "kinesin family member 7" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Score = 190 (71.9 bits), Expect = 7.1e-13, P = 7.1e-13
Identities = 42/97 (43%), Positives = 64/97 (65%)
Query: 102 VAVRIRPLLVKEL-HMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTII 160
VA+R+RPLL KEL H S + + P+R + + + + + F + LG+DT Q +V+
Sbjct: 18 VALRVRPLLPKELLHGHQSCLRVEPERGRITLGRD-RHFGFHV--VLGEDTGQEAVYQAC 74
Query: 161 AQPLLDAAFNGYNVCLFAYGQTGSGKSYR-GDSTLNS 196
QPLL+A F G+N +FAYGQTGSGK+Y G++++ S
Sbjct: 75 VQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVAS 111
|
|
| UNIPROTKB|F8WD21 KIF7 "Kinesin-like protein KIF7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1310650 Kif14 "kinesin family member 14" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q15058 KIF14 "Kinesin-like protein KIF14" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1310310 Kif7 "kinesin family member 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z355 KIF27 "Kinesin-like protein KIF27" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9PAQ6 KIF14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NT06 KIF7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R054 KIF14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PD49 KIF7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 262 | |||
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 2e-24 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 3e-22 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 4e-22 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 6e-22 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 1e-21 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 6e-21 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 9e-18 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 2e-16 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 1e-15 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 4e-15 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 1e-14 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 1e-14 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 4e-14 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 6e-14 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 2e-12 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 4e-11 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 9e-09 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 9e-09 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 5e-08 |
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
Score = 99.6 bits (249), Expect = 2e-24
Identities = 32/95 (33%), Positives = 42/95 (44%), Gaps = 5/95 (5%)
Query: 99 RMTVAVRIRPLLVKELHMDVSSIE--ISPDRREMKVNDNAK---SYTFKLDHCLGQDTDQ 153
+ V VR+RPL +E S+ + + V F D Q
Sbjct: 1 NIRVVVRVRPLNKREKSRKSPSVVPFPDKVGKTLTVRSPKNRQGEKKFTFDKVFDATASQ 60
Query: 154 TSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSY 188
VF A PL+D+ GYN +FAYGQTGSGK+Y
Sbjct: 61 EDVFEETAAPLVDSVLEGYNATIFAYGQTGSGKTY 95
|
ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division. Length = 335 |
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 262 | |||
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| KOG4280|consensus | 574 | 100.0 | ||
| KOG0243|consensus | 1041 | 100.0 | ||
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| KOG0242|consensus | 675 | 100.0 | ||
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| KOG0245|consensus | 1221 | 100.0 | ||
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| KOG0240|consensus | 607 | 100.0 | ||
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 100.0 | |
| KOG0239|consensus | 670 | 100.0 | ||
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| KOG0246|consensus | 676 | 100.0 | ||
| KOG0241|consensus | 1714 | 100.0 | ||
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| KOG0247|consensus | 809 | 99.97 | ||
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 99.94 | |
| KOG0244|consensus | 913 | 99.89 | ||
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 99.71 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 95.67 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 94.97 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 93.2 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 93.1 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 92.55 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 91.96 | |
| PRK09087 | 226 | hypothetical protein; Validated | 91.88 | |
| PRK06620 | 214 | hypothetical protein; Validated | 91.73 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 90.94 | |
| PRK06526 | 254 | transposase; Provisional | 90.04 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 89.91 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 89.1 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 88.73 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 88.68 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 88.43 | |
| PRK12377 | 248 | putative replication protein; Provisional | 88.18 | |
| PRK08116 | 268 | hypothetical protein; Validated | 87.76 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 87.75 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 87.17 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 87.11 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 86.56 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 86.15 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 85.97 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 85.96 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 85.68 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 85.26 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 85.2 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 85.04 | |
| PRK08181 | 269 | transposase; Validated | 84.89 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 84.78 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 84.25 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 84.22 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 83.95 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 83.93 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 83.74 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 83.59 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 82.87 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 82.6 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 82.59 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 82.52 | |
| PRK08727 | 233 | hypothetical protein; Validated | 82.12 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 82.1 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 81.87 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 81.71 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 80.8 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 80.69 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 80.62 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 80.56 |
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.8e-42 Score=313.65 Aligned_cols=164 Identities=23% Similarity=0.298 Sum_probs=148.2
Q ss_pred CeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCC------------CCceeeeeceeeCCCCCcchhhcccchhhH
Q psy17370 99 RMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDN------------AKSYTFKLDHCLGQDTDQTSVFTIIAQPLL 165 (262)
Q Consensus 99 ~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~------------~~~~~f~FD~vf~~~~~q~~vy~~~~~plv 165 (262)
+|+|+|||||++..|.. +...+|.+.++...+..+.. ...+.|.||+||+++++|++||+.+++|+|
T Consensus 1 ~i~V~vRvRP~~~~E~~~~~~~~v~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~f~Fd~vf~~~~~q~~vf~~~~~plv 80 (338)
T cd01370 1 SLTVAVRVRPFNEKEKQEGTRRVVKVVDDRMLVFDPKDEEDAFRNLRARRNKELKYSFDRVFDETSTQEEVYENTTKPLV 80 (338)
T ss_pred CeEEEEEcCCCChhhhhcCCceEEEEcCCCEEEEcCCcccccccchhcccCCceEEEeccccCCCCCHHHHHHHHHHHHH
Confidence 59999999999999876 67788888877655544432 146899999999999999999999999999
Q ss_pred hhhhCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCc----cceEEEEEEEEEE---EEecCC---CCc
Q psy17370 166 DAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH----SGWTGWVSCVVVI---AVDFGC---GSW 235 (262)
Q Consensus 166 ~~~l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~----~~~~~~vS~~EIy---l~Dll~---~~l 235 (262)
+.+++|+|+||||||||||||||||+|+..++|||||++++||..++. ..+.|+|||+||| ++|||. ..|
T Consensus 81 ~~~~~G~n~~i~ayGqtGSGKTyTm~G~~~~~Giipr~~~~LF~~i~~~~~~~~~~v~vS~~EIyne~v~DLL~~~~~~l 160 (338)
T cd01370 81 DGVLNGYNATVFAYGATGAGKTHTMLGTDSDPGLMVLTMKDLFDKIEERKDDKEFEVSLSYLEIYNETIRDLLSPSSGPL 160 (338)
T ss_pred HHHHCCCCceEEeeCCCCCCCeEEEcCCCCCCchHHHHHHHHHHhhhhcccCceEEEEEEEEEEECCEEEECCCCCCCCc
Confidence 999999999999999999999999999999999999999999998864 4689999999999 999995 579
Q ss_pred eeeecCCCcEEEcCceEEecCChhhhC
Q psy17370 236 RFESKPSHEIYLSVSVLTDITKFIEVY 262 (262)
Q Consensus 236 ~i~ed~~~~v~v~gl~~~~V~s~~e~l 262 (262)
+|++|.++++++.|++++.|.+.+|++
T Consensus 161 ~i~ed~~~~~~v~gl~~~~v~s~~e~~ 187 (338)
T cd01370 161 ELREDPNQGIVVAGLTEHQPKSAEEIL 187 (338)
T ss_pred eEEEcCCCCEEeCCcEEEEeCCHHHHH
Confidence 999999999999999999999999975
|
The yeast kinesin KIP3 plays a role in positioning the mitotic spindle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a sec |
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 262 | ||||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 3e-13 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 3e-13 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 6e-13 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 1e-11 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 1e-11 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 6e-11 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 8e-11 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 8e-11 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 8e-11 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 1e-10 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 1e-10 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 1e-10 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 1e-10 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 1e-10 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 1e-10 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 1e-10 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 2e-10 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 2e-10 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 2e-10 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 2e-10 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 2e-10 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 2e-10 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 2e-10 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 2e-10 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 4e-10 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 4e-10 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 4e-10 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 2e-09 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 2e-09 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 3e-09 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 5e-09 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 3e-08 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 4e-08 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 5e-08 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 2e-07 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 2e-07 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-07 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-07 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 2e-07 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 3e-07 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 5e-07 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 6e-07 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 1e-06 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 1e-06 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 3e-06 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 4e-06 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 5e-06 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-05 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 2e-05 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 2e-05 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 2e-05 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 3e-05 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 3e-05 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 9e-05 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 3e-04 |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
|
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 262 | |||
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 2e-28 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 4e-28 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 5e-28 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 6e-28 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 5e-27 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 7e-27 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 7e-27 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 9e-27 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 1e-26 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 1e-26 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 2e-26 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 3e-26 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 7e-26 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 2e-25 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 2e-25 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 2e-25 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 9e-25 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 1e-24 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 1e-24 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 6e-24 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 1e-23 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 1e-23 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 2e-23 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 2e-23 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 1e-21 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 1e-21 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 |
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
Score = 109 bits (276), Expect = 2e-28
Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 3/88 (3%)
Query: 102 VAVRIRPLLVKELHM-DVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTII 160
V VR+RPL +E + + + + D + D +KS+ F D + +V+ I
Sbjct: 8 VCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNF--DRVFHGNETTKNVYEEI 65
Query: 161 AQPLLDAAFNGYNVCLFAYGQTGSGKSY 188
A P++D+A GYN +FAYGQT SGK+Y
Sbjct: 66 AAPIIDSAIQGYNGTIFAYGQTASGKTY 93
|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 262 | |||
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 100.0 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 100.0 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 100.0 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 100.0 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 100.0 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 100.0 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 100.0 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 100.0 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 100.0 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 100.0 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 100.0 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 100.0 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 100.0 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 100.0 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 100.0 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 100.0 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 100.0 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 100.0 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 100.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 100.0 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 100.0 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 100.0 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 100.0 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 100.0 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 100.0 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 100.0 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 99.94 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 93.88 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 92.67 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 91.67 | |
| 4etp_B | 333 | Spindle POLE BODY-associated protein VIK1; kinesin | 89.72 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 88.58 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 87.44 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 86.4 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 84.61 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 84.0 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 83.93 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 83.72 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 83.69 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 83.4 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 83.0 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 82.82 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 81.7 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 81.37 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 81.06 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 80.23 |
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.8e-45 Score=335.55 Aligned_cols=167 Identities=22% Similarity=0.298 Sum_probs=146.4
Q ss_pred CCCCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCC----------CCceeeeeceeeCCCCCcchhhcccchhh
Q psy17370 96 ECSRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDN----------AKSYTFKLDHCLGQDTDQTSVFTIIAQPL 164 (262)
Q Consensus 96 ~~~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~----------~~~~~f~FD~vf~~~~~q~~vy~~~~~pl 164 (262)
..++|+|+||+||++.+|.. +...++.+.++...+.+... ...+.|+||+||+++++|++||+.+++|+
T Consensus 2 ~~~~i~V~vRvRP~~~~E~~~~~~~~v~~~~~~~~v~v~~~~~~~~~~~~~~~~~~f~FD~Vf~~~~~Q~~Vy~~~~~pl 81 (350)
T 2vvg_A 2 SSDNIKVIVRCRPLNARETRENALNIIRMDEASAQVIVDPPEQEKSATQAKKVPRTFTFDAVYDQTSCNYGIFQASFKPL 81 (350)
T ss_dssp --CBCEEEEEECCCCHHHHHTTCCBCEEEEGGGTEEEECC--------------EEEECSEEECTTCCHHHHHHHTTHHH
T ss_pred CCCCeEEEEEeCCCChhhhccCCceEEEEcCCCCEEEEeeccccccccccCCCceEeeCCEEECCCcchhHHHHHHHHHH
Confidence 46799999999999999976 66677887765555544331 25789999999999999999999999999
Q ss_pred HhhhhCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccC----ccceEEEEEEEEEE---EEecCC--CCc
Q psy17370 165 LDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWS----HSGWTGWVSCVVVI---AVDFGC--GSW 235 (262)
Q Consensus 165 v~~~l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~----~~~~~~~vS~~EIy---l~Dll~--~~l 235 (262)
|+.+|+|||+||||||||||||||||+|+.+++|||||++++||..++ ...|.+++||+||| |+|||. .+|
T Consensus 82 v~~~l~G~n~tifAYGqTGSGKTyTm~G~~~~~Giipr~~~~lF~~i~~~~~~~~~~v~vS~~EIYnE~i~DLL~~~~~l 161 (350)
T 2vvg_A 82 IDAVLEGFNSTIFAYGQTGAGKTWTMGGNKEEPGAIPNSFKHLFDAINSSSSNQNFLVIGSYLELYNEEIRDLIKNNTKL 161 (350)
T ss_dssp HHHHHTTCCEEEEEECSTTSSHHHHHTBCSSSBCHHHHHHHHHHHHHHTCCTTEEEEEEEEEEEEETTEEEETTTTEEEE
T ss_pred HHHHhCCCceeEEeecCCCCCCCEEeecCCccCchHHHHHHHHHHHHHhhccCCcEEEEEEEEEEeCCEEEEcccCCcCc
Confidence 999999999999999999999999999999999999999999999875 35899999999999 999996 568
Q ss_pred eeeecCCCcEEEcCceEEecCChhhhC
Q psy17370 236 RFESKPSHEIYLSVSVLTDITKFIEVY 262 (262)
Q Consensus 236 ~i~ed~~~~v~v~gl~~~~V~s~~e~l 262 (262)
+|+||+.+++||.|++++.|.+.+|++
T Consensus 162 ~i~e~~~~~~~v~gl~~~~v~s~~e~~ 188 (350)
T 2vvg_A 162 PLKEDKTRGIYVDGLSMHRVTTAAELS 188 (350)
T ss_dssp CEEEETTTEEEETTCCCEEESSHHHHH
T ss_pred eeeEcCCCCEEecCCEEEEcCCHHHHH
Confidence 999999999999999999999999974
|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >4etp_B Spindle POLE BODY-associated protein VIK1; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 262 | ||||
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 5e-19 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 2e-17 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 1e-16 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 2e-15 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 2e-15 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 3e-15 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 7e-14 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 9e-13 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 1e-10 |
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Mouse (Mus musculus), kif2c [TaxId: 10090]
Score = 83.0 bits (204), Expect = 5e-19
Identities = 38/188 (20%), Positives = 63/188 (33%), Gaps = 18/188 (9%)
Query: 74 IKLPRANLIMRSSSENCVADNLECSRMTVAVRIRPLLVKELHM---------DVSSIEIS 124
IK R + + D +E R+ V VR RPL +EL + +
Sbjct: 9 IKEFRVTMECSPLTVT---DPIEEHRICVCVRKRPLNKQELAKKEIDVISVPSKCLLLVH 65
Query: 125 PDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGS 184
+ ++ + ++ F D + V+ A+PL+ F G FAYGQTGS
Sbjct: 66 EPKLKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGS 125
Query: 185 GKSY------RGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRFE 238
GK++ G S S + + + V V + G
Sbjct: 126 GKTHTMGGDLSGKSQNASKGIYAMASRDVFLLKNQPRYRNLNLEVYVTFFEIYNGKVFDL 185
Query: 239 SKPSHEIY 246
++
Sbjct: 186 LNKKAKLR 193
|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 262 | |||
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.04 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 92.6 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 90.32 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 88.97 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 87.03 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 86.46 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 85.36 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 84.69 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 84.57 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 84.09 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 84.01 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 83.31 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 82.77 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 82.45 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 82.45 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 81.24 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 81.1 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 80.99 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 80.99 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 80.01 |
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Mouse (Mus musculus), kif2c [TaxId: 10090]
Probab=100.00 E-value=1.4e-41 Score=311.72 Aligned_cols=167 Identities=22% Similarity=0.246 Sum_probs=145.0
Q ss_pred CCCCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCC-C-------CceeeeeceeeCCCCCcchhhcccchhhHh
Q psy17370 96 ECSRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDN-A-------KSYTFKLDHCLGQDTDQTSVFTIIAQPLLD 166 (262)
Q Consensus 96 ~~~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~-~-------~~~~f~FD~vf~~~~~q~~vy~~~~~plv~ 166 (262)
++++|+|+||+||++..|.. ++..+|.+.++...+...+. . ..+.|+||+||+++++|++||+.++.|+|+
T Consensus 28 ~~~~I~V~vRvRPl~~~E~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~f~FD~vf~~~~~Q~~Vy~~~~~plv~ 107 (362)
T d1v8ka_ 28 EEHRICVCVRKRPLNKQELAKKEIDVISVPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQ 107 (362)
T ss_dssp SCCCEEEEEEECCCCHHHHHTTCCBCEECCSSSEEEEEEEEECTTCCEEEEEEEEECSEEECTTCCHHHHHHHTTHHHHH
T ss_pred CCCCEEEEEEeCCCChHHhhCCCceEEEECCCcEEEEeCCccccccccCcCceeEeCCeecCCCCCHHHHHHHHHHHHHH
Confidence 46789999999999999876 66677777665544433211 1 457899999999999999999999999999
Q ss_pred hhhCCCceeEeeeeccCCCCceecCCCC------CCCchHhhhhhccccccCc-----cceEEEEEEEEEE---EEecCC
Q psy17370 167 AAFNGYNVCLFAYGQTGSGKSYRGDSTL------NSSVLRPRVLFYPGFSWSH-----SGWTGWVSCVVVI---AVDFGC 232 (262)
Q Consensus 167 ~~l~G~n~~ifaYG~tgSGKTyTm~G~~------~~~Giipr~~~~lf~~~~~-----~~~~~~vS~~EIy---l~Dll~ 232 (262)
.+|+|+|+||||||||||||||||+|+. .++||+||++++||..+++ ..|.|++||+||| ++|||.
T Consensus 108 ~~l~G~n~tifaYGqTGSGKTyTm~G~~~~~~~~~~~Giipr~~~~lf~~~~~~~~~~~~~~v~vS~~EIyne~i~DLL~ 187 (362)
T d1v8ka_ 108 TIFEGGKATCFAYGQTGSGKTHTMGGDLSGKSQNASKGIYAMASRDVFLLKNQPRYRNLNLEVYVTFFEIYNGKVFDLLN 187 (362)
T ss_dssp HHHTTCEEEEEEEESTTSSHHHHHHCBC----CBGGGSHHHHHHHHHHHHHTSHHHHTTCCEEEEEEEEEETTEEEETTT
T ss_pred HHHhccCceEEeeccCCCCCceeeeecCCCCcccccCCeeeehhhhHHHHhhcccccccchhheeeeeeecCCeEEeccc
Confidence 9999999999999999999999999975 3689999999999987764 3799999999999 999995
Q ss_pred --CCceeeecCCCcEEEcCceEEecCChhhhC
Q psy17370 233 --GSWRFESKPSHEIYLSVSVLTDITKFIEVY 262 (262)
Q Consensus 233 --~~l~i~ed~~~~v~v~gl~~~~V~s~~e~l 262 (262)
..+.++++..+++++.|++++.|.+.+|++
T Consensus 188 ~~~~~~~~~~~~~~~~v~gl~e~~v~s~~e~~ 219 (362)
T d1v8ka_ 188 KKAKLRVLEDSRQQVQVVGLQEYLVTCADDVI 219 (362)
T ss_dssp TTEEEEEEECSSCCEEEETCCCEEESSHHHHH
T ss_pred CCccccccccccCCcccCCCEEEEecCHHHHH
Confidence 556888999999999999999999999974
|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|