Psyllid ID: psy17370


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MSTKSNPRALFSSTPVKKNEGPIATLSSSNQSKPKEKFVKPATPKTPLATANYERCIQARRAMSADRSPATPKIKLPRANLIMRSSSENCVADNLECSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRFESKPSHEIYLSVSVLTDITKFIEVY
cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHcccccccccEEEEEccccccHHHccccccEEEcccccEEEEccccccEEEEccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEccccccccEEccccccccccHHHHHHHHHHHccccccEEEEEEEEEEEEEEEcccccccccccccccccccEEccccccEEEc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHccccEEEEEccccEEEEcccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccEEEccccccccccHHHHHHHHHHHHHHccccEEEEEEEEEEEEcHHHHHHccccccccccccccEccccccEEEEc
mstksnpralfsstpvkknegpiatlsssnqskpkekfvkpatpktplatanYERCIQARRAmsadrspatpkiklpranlimrsssencvadnlecsrmTVAVRIRPLLVKELhmdvssieispdrremkvndnaksytfkldhclgqdtdqtsVFTIIAQPLLDAAFNGYNVCLfaygqtgsgksyrgdstlnssvlrprvlfypgfswshsgwtgWVSCVVVIAVDFgcgswrfeskpsheiyLSVSVLTDITKFIEVY
mstksnpralfsstpvkknegpiatlsssnqskpkekfvkpatpktplataNYERCIQARramsadrspatpkiklpranlimrsSSENCVADNLECSRMTVAVRIRPllvkelhmdvssieispdrremkvNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRFeskpsheiylsvsvltditKFIEVY
MSTKSNPRALFSSTPVKKNEGPIATLSSSNQSKPKEKFVKPATPKTPLATANYERCIQARRAMSADRSPATPKIKLPRANLIMRSSSENCVADNLECSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRFESKPSHEIYLSVSVLTDITKFIEVY
****************************************************************************************NCVADNLECSRMTVAVRIRPLLVKELHMDVSSIE*************AKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRFESKPSHEIYLSVSVLTDITKFIE**
***************************************************************************************************MTVAVRIRPLLVKEL************************YTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRF******************TKFIEVY
MSTKSNPRALFSSTPVKKNEGPIAT****************ATPKTPLATANYERCIQARR********ATPKIKLPRANLIMRSSSENCVADNLECSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRFESKPSHEIYLSVSVLTDITKFIEVY
*************************************************************************************************SRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRFESKPSHEIYLSVSVLTDITKFIEVY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTKSNPRALFSSTPVKKNEGPIATLSSSNQSKPKEKFVKPATPKTPLATANYERCIQARRAMSADRSPATPKIKLPRANLIMRSSSENCVADNLECSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRFESKPSHEIYLSVSVLTDITKFIEVY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query262 2.2.26 [Sep-21-2011]
Q15058 1648 Kinesin-like protein KIF1 yes N/A 0.427 0.067 0.377 7e-14
B7ZNG0 1348 Kinesin-like protein KIF7 no N/A 0.351 0.068 0.432 1e-13
Q5VQ09 891 Armadillo repeat-containi yes N/A 0.347 0.102 0.357 6e-12
Q58G59 1363 Kinesin-like protein kif7 yes N/A 0.377 0.072 0.394 7e-12
Q9NQT8 1826 Kinesin-like protein KIF1 no N/A 0.389 0.055 0.362 1e-11
Q2M1P5 1343 Kinesin-like protein KIF7 no N/A 0.351 0.068 0.402 2e-11
Q86VH2 1401 Kinesin-like protein KIF2 no N/A 0.328 0.061 0.388 3e-11
Q9FZ06 919 Armadillo repeat-containi yes N/A 0.343 0.097 0.361 4e-11
Q9LPC6 894 Armadillo repeat-containi no N/A 0.400 0.117 0.345 4e-11
Q7M6Z4 1394 Kinesin-like protein KIF2 no N/A 0.328 0.061 0.388 2e-10
>sp|Q15058|KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens GN=KIF14 PE=1 SV=1 Back     alignment and function desciption
 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 68/122 (55%), Gaps = 10/122 (8%)

Query: 76  LPRANLIMRSSSENCVADNLECSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVN-- 133
           LP    +++++S       +E S++TVAVR+RP   +E  ++ +S  +    +E+ V   
Sbjct: 335 LPEEETVVQNTSAGKDPLKVENSQVTVAVRVRPFTKRE-KIEKASQVVFMSGKEITVEHP 393

Query: 134 DNAKSYTF-------KLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGK 186
           D  + Y F         D C      QT+V+  +A PLL+ AF G+N CLFAYGQTGSGK
Sbjct: 394 DTKQVYNFIYDVSFWSFDECHPHYASQTTVYEKLAAPLLERAFEGFNTCLFAYGQTGSGK 453

Query: 187 SY 188
           SY
Sbjct: 454 SY 455




Plays an essential role in cytokinesis.
Homo sapiens (taxid: 9606)
>sp|B7ZNG0|KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus GN=Kif7 PE=1 SV=1 Back     alignment and function description
>sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein 2 OS=Oryza sativa subsp. japonica GN=Os06g0137100 PE=2 SV=1 Back     alignment and function description
>sp|Q58G59|KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio GN=kif7 PE=1 SV=1 Back     alignment and function description
>sp|Q9NQT8|KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens GN=KIF13B PE=1 SV=1 Back     alignment and function description
>sp|Q2M1P5|KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens GN=KIF7 PE=1 SV=2 Back     alignment and function description
>sp|Q86VH2|KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens GN=KIF27 PE=2 SV=1 Back     alignment and function description
>sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like protein 3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like protein 2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2 Back     alignment and function description
>sp|Q7M6Z4|KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus GN=Kif27 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query262
189237405 619 PREDICTED: similar to kinesin-like prote 0.541 0.229 0.371 5e-15
270008161 704 nebbish [Tribolium castaneum] 0.541 0.201 0.371 5e-15
383862963 1199 PREDICTED: kinesin-like protein KIF14-li 0.679 0.148 0.315 1e-13
322798327 525 hypothetical protein SINV_08845 [Solenop 0.354 0.177 0.445 4e-13
170043367 533 kinesin-II 85 kDa subunit [Culex quinque 0.351 0.172 0.439 4e-13
149058501 639 kinesin family member 14 (predicted) [Ra 0.435 0.178 0.366 5e-13
332024101 529 Kinesin-like protein KIF14 [Acromyrmex e 0.354 0.175 0.435 6e-13
157125836 1151 kinesin-like protein KIF1B [Aedes aegypt 0.354 0.080 0.405 7e-13
189233731 619 PREDICTED: similar to AGAP002427-PA [Tri 0.484 0.205 0.337 1e-12
291402681 1633 PREDICTED: kinesin family member 14 [Ory 0.408 0.065 0.408 1e-12
>gi|189237405|ref|XP_973631.2| PREDICTED: similar to kinesin-like protein KIF1B [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 87.4 bits (215), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 87/167 (52%), Gaps = 25/167 (14%)

Query: 36  EKFVKPATPKTPLATANYERCIQARRAMSADRSPATPKIKLPRANLIMRSSSENCVADNL 95
           E FV P TP+  LAT       ++ RA +     +T  ++ P + L  RSS E       
Sbjct: 32  EGFVAPTTPRN-LATP------KSNRAANTPECFSTVTLETPNSALKRRSSKEKFD---- 80

Query: 96  ECSRMTVAVRIRPLLVKELHMDVSSIEISPDRREMKVNDN-------AKSYTFKLDH--- 145
             S +TVAVRIRP+  +EL    ++  +    +E+ +  N       +  + F+ DH   
Sbjct: 81  RVSNLTVAVRIRPMNSRELACVGAANVVKVRNQELVIRSNPLGNSAMSLDHVFQYDHIFW 140

Query: 146 -CLGQDT---DQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSY 188
            C   D+    Q  VFT + QPLL++AF GYN CLFAYGQTGSGKS+
Sbjct: 141 SCDESDSLYSSQEDVFTTVGQPLLNSAFRGYNACLFAYGQTGSGKSF 187




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270008161|gb|EFA04609.1| nebbish [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383862963|ref|XP_003706952.1| PREDICTED: kinesin-like protein KIF14-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322798327|gb|EFZ20067.1| hypothetical protein SINV_08845 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|170043367|ref|XP_001849362.1| kinesin-II 85 kDa subunit [Culex quinquefasciatus] gi|167866727|gb|EDS30110.1| kinesin-II 85 kDa subunit [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|149058501|gb|EDM09658.1| kinesin family member 14 (predicted) [Rattus norvegicus] Back     alignment and taxonomy information
>gi|332024101|gb|EGI64317.1| Kinesin-like protein KIF14 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157125836|ref|XP_001660806.1| kinesin-like protein KIF1B [Aedes aegypti] gi|108882659|gb|EAT46884.1| AAEL001986-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|189233731|ref|XP_971025.2| PREDICTED: similar to AGAP002427-PA [Tribolium castaneum] gi|270015046|gb|EFA11494.1| hypothetical protein TcasGA2_TC014207 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|291402681|ref|XP_002717707.1| PREDICTED: kinesin family member 14 [Oryctolagus cuniculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query262
MGI|MGI:1098239 1348 Kif7 "kinesin family member 7" 0.351 0.068 0.432 7.1e-13
UNIPROTKB|F8WD21147 KIF7 "Kinesin-like protein KIF 0.343 0.612 0.4 9.1e-13
RGD|1310650639 Kif14 "kinesin family member 1 0.358 0.147 0.441 1.5e-12
UNIPROTKB|Q15058 1648 KIF14 "Kinesin-like protein KI 0.587 0.093 0.341 2.6e-12
RGD|1310310 1341 Kif7 "kinesin family member 7" 0.351 0.068 0.422 2.9e-12
UNIPROTKB|F2Z355171 KIF27 "Kinesin-like protein KI 0.320 0.491 0.409 4.8e-12
UNIPROTKB|J9PAQ6540 KIF14 "Uncharacterized protein 0.358 0.174 0.431 6.9e-12
UNIPROTKB|J9NT06 596 KIF7 "Uncharacterized protein" 0.351 0.154 0.412 1.6e-11
UNIPROTKB|E2R054 1646 KIF14 "Uncharacterized protein 0.358 0.057 0.431 3.3e-11
UNIPROTKB|F1PD49 1355 KIF7 "Uncharacterized protein" 0.351 0.067 0.412 5e-11
MGI|MGI:1098239 Kif7 "kinesin family member 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 190 (71.9 bits), Expect = 7.1e-13, P = 7.1e-13
 Identities = 42/97 (43%), Positives = 64/97 (65%)

Query:   102 VAVRIRPLLVKEL-HMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTII 160
             VA+R+RPLL KEL H   S + + P+R  + +  + + + F +   LG+DT Q +V+   
Sbjct:    18 VALRVRPLLPKELLHGHQSCLRVEPERGRITLGRD-RHFGFHV--VLGEDTGQEAVYQAC 74

Query:   161 AQPLLDAAFNGYNVCLFAYGQTGSGKSYR-GDSTLNS 196
              QPLL+A F G+N  +FAYGQTGSGK+Y  G++++ S
Sbjct:    75 VQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVAS 111




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003777 "microtubule motor activity" evidence=ISO
GO:0005515 "protein binding" evidence=IPI
GO:0005524 "ATP binding" evidence=IEA
GO:0005874 "microtubule" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IEA
GO:0005929 "cilium" evidence=ISO;IDA
GO:0007018 "microtubule-based movement" evidence=IEA
GO:0042995 "cell projection" evidence=IEA
GO:0045879 "negative regulation of smoothened signaling pathway" evidence=IMP
GO:0045880 "positive regulation of smoothened signaling pathway" evidence=IMP
UNIPROTKB|F8WD21 KIF7 "Kinesin-like protein KIF7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1310650 Kif14 "kinesin family member 14" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q15058 KIF14 "Kinesin-like protein KIF14" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1310310 Kif7 "kinesin family member 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z355 KIF27 "Kinesin-like protein KIF27" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9PAQ6 KIF14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NT06 KIF7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R054 KIF14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PD49 KIF7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
smart00129 335 smart00129, KISc, Kinesin motor, catalytic domain 2e-24
pfam00225 326 pfam00225, Kinesin, Kinesin motor domain 3e-22
cd00106 328 cd00106, KISc, Kinesin motor domain 4e-22
cd01372 341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 6e-22
cd01365 356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 1e-21
cd01366 329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 6e-21
cd01364 352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 9e-18
cd01375 334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 2e-16
cd01370 338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 1e-15
cd01369 325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 4e-15
cd01371 333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 1e-14
cd01373 337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 1e-14
cd01367 322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 4e-14
cd01374 321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 6e-14
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 2e-12
cd01368 345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 4e-11
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 9e-09
cd01376 319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 9e-09
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 5e-08
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
 Score = 99.6 bits (249), Expect = 2e-24
 Identities = 32/95 (33%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

Query: 99  RMTVAVRIRPLLVKELHMDVSSIE--ISPDRREMKVNDNAK---SYTFKLDHCLGQDTDQ 153
            + V VR+RPL  +E      S+        + + V           F  D        Q
Sbjct: 1   NIRVVVRVRPLNKREKSRKSPSVVPFPDKVGKTLTVRSPKNRQGEKKFTFDKVFDATASQ 60

Query: 154 TSVFTIIAQPLLDAAFNGYNVCLFAYGQTGSGKSY 188
             VF   A PL+D+   GYN  +FAYGQTGSGK+Y
Sbjct: 61  EDVFEETAAPLVDSVLEGYNATIFAYGQTGSGKTY 95


ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division. Length = 335

>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 262
cd01370 338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
cd01368 345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
KOG4280|consensus 574 100.0
KOG0243|consensus 1041 100.0
cd01373 337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
cd01365 356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
cd01367 322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
KOG0242|consensus 675 100.0
cd01376 319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01374 321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01371 333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
KOG0245|consensus 1221 100.0
cd01369 325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
KOG0240|consensus 607 100.0
cd01364 352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
cd01372 341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
cd01366 329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
cd01375 334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
cd00106 328 KISc Kinesin motor domain. This catalytic (head) d 100.0
KOG0239|consensus 670 100.0
smart00129 335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
KOG0246|consensus 676 100.0
KOG0241|consensus 1714 100.0
PF00225 335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
KOG0247|consensus 809 99.97
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 99.94
KOG0244|consensus 913 99.89
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 99.71
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 95.67
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.97
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction 93.2
PRK06893 229 DNA replication initiation factor; Validated 93.1
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 92.55
PRK14086 617 dnaA chromosomal replication initiation protein; P 91.96
PRK09087226 hypothetical protein; Validated 91.88
PRK06620214 hypothetical protein; Validated 91.73
PRK05642234 DNA replication initiation factor; Validated 90.94
PRK06526254 transposase; Provisional 90.04
PRK14088 440 dnaA chromosomal replication initiation protein; P 89.91
PRK08084 235 DNA replication initiation factor; Provisional 89.1
PF04851184 ResIII: Type III restriction enzyme, res subunit; 88.73
PRK14087 450 dnaA chromosomal replication initiation protein; P 88.68
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 88.43
PRK12377248 putative replication protein; Provisional 88.18
PRK08116268 hypothetical protein; Validated 87.76
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 87.75
PRK00149 450 dnaA chromosomal replication initiation protein; R 87.17
PRK00411 394 cdc6 cell division control protein 6; Reviewed 87.11
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 86.56
PF01935 229 DUF87: Domain of unknown function DUF87; InterPro: 86.15
PRK07952244 DNA replication protein DnaC; Validated 85.97
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 85.96
PRK08903227 DnaA regulatory inactivator Hda; Validated 85.68
TIGR02533 486 type_II_gspE general secretory pathway protein E. 85.26
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 85.2
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 85.04
PRK08181269 transposase; Validated 84.89
PRK10436 462 hypothetical protein; Provisional 84.78
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 84.25
COG1484254 DnaC DNA replication protein [DNA replication, rec 84.22
PF1324576 AAA_19: Part of AAA domain 83.95
COG0593 408 DnaA ATPase involved in DNA replication initiation 83.93
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 83.74
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 83.59
PF12846 304 AAA_10: AAA-like domain 82.87
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 82.6
PRK06835329 DNA replication protein DnaC; Validated 82.59
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 82.52
PRK08727 233 hypothetical protein; Validated 82.12
PRK08939306 primosomal protein DnaI; Reviewed 82.1
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 81.87
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 81.71
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 80.8
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 80.69
PRK13894319 conjugal transfer ATPase TrbB; Provisional 80.62
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 80.56
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
Probab=100.00  E-value=9.8e-42  Score=313.65  Aligned_cols=164  Identities=23%  Similarity=0.298  Sum_probs=148.2

Q ss_pred             CeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCC------------CCceeeeeceeeCCCCCcchhhcccchhhH
Q psy17370         99 RMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDN------------AKSYTFKLDHCLGQDTDQTSVFTIIAQPLL  165 (262)
Q Consensus        99 ~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~------------~~~~~f~FD~vf~~~~~q~~vy~~~~~plv  165 (262)
                      +|+|+|||||++..|.. +...+|.+.++...+..+..            ...+.|.||+||+++++|++||+.+++|+|
T Consensus         1 ~i~V~vRvRP~~~~E~~~~~~~~v~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~f~Fd~vf~~~~~q~~vf~~~~~plv   80 (338)
T cd01370           1 SLTVAVRVRPFNEKEKQEGTRRVVKVVDDRMLVFDPKDEEDAFRNLRARRNKELKYSFDRVFDETSTQEEVYENTTKPLV   80 (338)
T ss_pred             CeEEEEEcCCCChhhhhcCCceEEEEcCCCEEEEcCCcccccccchhcccCCceEEEeccccCCCCCHHHHHHHHHHHHH
Confidence            59999999999999876 67788888877655544432            146899999999999999999999999999


Q ss_pred             hhhhCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccCc----cceEEEEEEEEEE---EEecCC---CCc
Q psy17370        166 DAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWSH----SGWTGWVSCVVVI---AVDFGC---GSW  235 (262)
Q Consensus       166 ~~~l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~~----~~~~~~vS~~EIy---l~Dll~---~~l  235 (262)
                      +.+++|+|+||||||||||||||||+|+..++|||||++++||..++.    ..+.|+|||+|||   ++|||.   ..|
T Consensus        81 ~~~~~G~n~~i~ayGqtGSGKTyTm~G~~~~~Giipr~~~~LF~~i~~~~~~~~~~v~vS~~EIyne~v~DLL~~~~~~l  160 (338)
T cd01370          81 DGVLNGYNATVFAYGATGAGKTHTMLGTDSDPGLMVLTMKDLFDKIEERKDDKEFEVSLSYLEIYNETIRDLLSPSSGPL  160 (338)
T ss_pred             HHHHCCCCceEEeeCCCCCCCeEEEcCCCCCCchHHHHHHHHHHhhhhcccCceEEEEEEEEEEECCEEEECCCCCCCCc
Confidence            999999999999999999999999999999999999999999998864    4689999999999   999995   579


Q ss_pred             eeeecCCCcEEEcCceEEecCChhhhC
Q psy17370        236 RFESKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       236 ~i~ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      +|++|.++++++.|++++.|.+.+|++
T Consensus       161 ~i~ed~~~~~~v~gl~~~~v~s~~e~~  187 (338)
T cd01370         161 ELREDPNQGIVVAGLTEHQPKSAEEIL  187 (338)
T ss_pred             eEEEcCCCCEEeCCcEEEEeCCHHHHH
Confidence            999999999999999999999999975



The yeast kinesin KIP3 plays a role in positioning the mitotic spindle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a sec

>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>KOG4280|consensus Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>KOG0245|consensus Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
2xt3_A 344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 3e-13
4a14_A 344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 3e-13
3gbj_A 354 Crystal Structure Of The Motor Domain Of Kinesin Ki 6e-13
4aqv_C 373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 1e-11
4gkr_A 371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 1e-11
3u06_A 412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 6e-11
1n6m_A 409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 8e-11
2ncd_A 420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 8e-11
1cz7_A 406 The Crystal Structure Of A Minus-End Directed Micro 8e-11
1ii6_A 368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 1e-10
4a1z_A 368 Eg5-1 Length = 368 1e-10
4ap0_A 370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 1e-10
1q0b_A 367 Crystal Structure Of The Motor Protein Ksp In Compl 1e-10
3hqd_A 369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 1e-10
1ia0_K 394 Kif1a Head-Microtubule Complex Structure In Atp-For 1e-10
1f9u_A 347 Crystal Structures Of Mutants Reveal A Signalling P 1e-10
1f9w_A 347 Crystal Structures Of Mutants Reveal A Signalling P 2e-10
3kar_A 346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 2e-10
1f9v_A 347 Crystal Structures Of Mutants Reveal A Signalling P 2e-10
1f9t_A 358 Crystal Structures Of Kinesin Mutants Reveal A Sign 2e-10
4a28_A 368 Eg5-2 Length = 368 2e-10
1x88_A 359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 2e-10
3zcw_A 348 Eg5 - New Allosteric Binding Site Length = 348 2e-10
3l1c_A 383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 2e-10
1i5s_A 367 Crystal Structure Of The Kif1a Motor Domain Complex 4e-10
1vfv_A 366 Crystal Structure Of The Kif1a Motor Domain Complex 4e-10
1i6i_A 366 Crystal Structure Of The Kif1a Motor Domain Complex 4e-10
4etp_A 403 C-Terminal Motor And Motor Homology Domain Of Kar3v 2e-09
2wbe_C 373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 2e-09
3t0q_A 349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 3e-09
1t5c_A 349 Crystal Structure Of The Motor Domain Of Human Kine 5e-09
2rep_A 376 Crystal Structure Of The Motor Domain Of Human Kine 3e-08
2h58_A 330 Crystal Structure Of The Kifc3 Motor Domain In Comp 4e-08
3nwn_A 359 Crystal Structure Of The Human Kif9 Motor Domain In 5e-08
2owm_A 443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 2e-07
2vvg_A 350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 2e-07
3b6v_A 395 Crystal Structure Of The Motor Domain Of Human Kine 2e-07
3b6u_A 372 Crystal Structure Of The Motor Domain Of Human Kine 2e-07
1sdm_A 369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 2e-07
3lre_A 355 Crystal Structure Analysis Of Human Kinesin-8 Motor 3e-07
2gry_A 420 Crystal Structure Of The Human Kif2 Motor Domain In 5e-07
1goj_A 355 Structure Of A Fast Kinesin: Implications For Atpas 6e-07
1v8j_A 410 The Crystal Structure Of The Minimal Functional Dom 1e-06
2heh_A 387 Crystal Structure Of The Kif2c Motor Domain (Casp T 1e-06
3h4s_A 386 Structure Of The Complex Of A Mitotic Kinesin With 3e-06
4h1g_A 715 Structure Of Candida Albicans Kar3 Motor Domain Fus 4e-06
2kin_A238 Kinesin (Monomeric) From Rattus Norvegicus Length = 5e-06
3bfn_A 388 Crystal Structure Of The Motor Domain Of Human Kine 2e-05
1mkj_A 349 Human Kinesin Motor Domain With Docked Neck Linker 2e-05
1bg2_A 325 Human Ubiquitous Kinesin Motor Domain Length = 325 2e-05
4atx_C 340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 2e-05
3dc4_A 344 Crystal Structure Of The Drosophila Kinesin Family 3e-05
3pxn_A 344 Crystal Structure Of The Drosophila Kinesin Family 3e-05
3edl_D 331 Kinesin13-Microtubule Ring Complex Length = 331 9e-05
2y5w_A 365 Crystal Structure Of Drosophila Melanogaster Kinesi 3e-04
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure

Iteration: 1

Score = 72.0 bits (175), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 4/88 (4%) Query: 102 VAVRIRPLLVKEL-HMDVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTII 160 VA+R+RPLL KEL H S +++ P + + + F L +D Q +V+ Sbjct: 15 VALRVRPLLPKELLHGHQSCLQVEPGLGRVTL---GRDRHFGFHVVLAEDAGQEAVYQAC 71 Query: 161 AQPLLDAAFNGYNVCLFAYGQTGSGKSY 188 QPLL+A F G+N +FAYGQTGSGK+Y Sbjct: 72 VQPLLEAFFEGFNATVFAYGQTGSGKTY 99
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 2e-28
3dc4_A 344 Kinesin-like protein NOD; catalytic domain, ATPase 4e-28
4a14_A 344 Kinesin, kinesin-like protein KIF7; motor protein, 5e-28
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 6e-28
3gbj_A 354 KIF13B protein; kinesin, motor domain, ADP, struct 5e-27
1v8k_A 410 Kinesin-like protein KIF2C; microtubule destabiliz 7e-27
3b6u_A 372 Kinesin-like protein KIF3B; structural genomics co 7e-27
1x88_A 359 Kinesin-like protein KIF11; switch II, motor domai 9e-27
2heh_A 387 KIF2C protein; kinesin, motor domain, ADP, structu 1e-26
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 1e-26
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 2e-26
3bfn_A 388 Kinesin-like protein KIF22; limited proteolysis, s 3e-26
1bg2_A 325 Kinesin; motor protein, ATPase, microtubule associ 7e-26
2wbe_C 373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 2e-25
2zfi_A 366 Kinesin-like protein KIF1A, kinesin heavy chain is 2e-25
2vvg_A 350 Kinesin-2; motor protein, nucleotide-binding, micr 2e-25
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 9e-25
3lre_A 355 Kinesin-like protein KIF18A; motor protein, nucleo 1e-24
2h58_A 330 Kinesin-like protein KIFC3 variant; motor domain, 1e-24
1f9v_A 347 Kinesin-like protein KAR3; kinesin-related protein 6e-24
2nr8_A 358 Kinesin-like protein KIF9; motor domain, ADP, stru 1e-23
3t0q_A 349 AGR253WP; kinesin, alpha and beta proteins, P-loop 1e-23
3u06_A 412 Protein claret segregational; motor domain, stalk 2e-23
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 2e-23
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 1e-21
2rep_A 376 Kinesin-like protein KIFC1; structural genomics co 1e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
 Score =  109 bits (276), Expect = 2e-28
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 3/88 (3%)

Query: 102 VAVRIRPLLVKELHM-DVSSIEISPDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTII 160
           V VR+RPL  +E  + + + +    D   +   D +KS+ F  D     +    +V+  I
Sbjct: 8   VCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNF--DRVFHGNETTKNVYEEI 65

Query: 161 AQPLLDAAFNGYNVCLFAYGQTGSGKSY 188
           A P++D+A  GYN  +FAYGQT SGK+Y
Sbjct: 66  AAPIIDSAIQGYNGTIFAYGQTASGKTY 93


>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query262
2vvg_A 350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 100.0
3lre_A 355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
3bfn_A 388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
4a14_A 344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
1bg2_A 325 Kinesin; motor protein, ATPase, microtubule associ 100.0
3b6u_A 372 Kinesin-like protein KIF3B; structural genomics co 100.0
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
2zfi_A 366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
2h58_A 330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
1x88_A 359 Kinesin-like protein KIF11; switch II, motor domai 100.0
2heh_A 387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 100.0
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
3gbj_A 354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
1v8k_A 410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
2wbe_C 373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
2rep_A 376 Kinesin-like protein KIFC1; structural genomics co 100.0
3u06_A 412 Protein claret segregational; motor domain, stalk 100.0
3nwn_A 359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
2nr8_A 358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 100.0
3t0q_A 349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
1f9v_A 347 Kinesin-like protein KAR3; kinesin-related protein 100.0
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
3dc4_A 344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
4h1g_A 715 Maltose binding protein-cakar3 motor domain fusio; 100.0
2o0a_A 298 S.cerevisiae chromosome XVI reading frame ORF YPL2 99.94
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.88
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 92.67
2qgz_A308 Helicase loader, putative primosome component; str 91.67
4etp_B 333 Spindle POLE BODY-associated protein VIK1; kinesin 89.72
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 88.58
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 87.44
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 86.4
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 84.61
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 84.0
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 83.93
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 83.72
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 83.69
2kjq_A149 DNAA-related protein; solution structure, NESG, st 83.4
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 83.0
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 82.82
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 81.7
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 81.37
3bor_A237 Human initiation factor 4A-II; translation initiat 81.06
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 80.23
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
Probab=100.00  E-value=3.8e-45  Score=335.55  Aligned_cols=167  Identities=22%  Similarity=0.298  Sum_probs=146.4

Q ss_pred             CCCCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCC----------CCceeeeeceeeCCCCCcchhhcccchhh
Q psy17370         96 ECSRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDN----------AKSYTFKLDHCLGQDTDQTSVFTIIAQPL  164 (262)
Q Consensus        96 ~~~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~----------~~~~~f~FD~vf~~~~~q~~vy~~~~~pl  164 (262)
                      ..++|+|+||+||++.+|.. +...++.+.++...+.+...          ...+.|+||+||+++++|++||+.+++|+
T Consensus         2 ~~~~i~V~vRvRP~~~~E~~~~~~~~v~~~~~~~~v~v~~~~~~~~~~~~~~~~~~f~FD~Vf~~~~~Q~~Vy~~~~~pl   81 (350)
T 2vvg_A            2 SSDNIKVIVRCRPLNARETRENALNIIRMDEASAQVIVDPPEQEKSATQAKKVPRTFTFDAVYDQTSCNYGIFQASFKPL   81 (350)
T ss_dssp             --CBCEEEEEECCCCHHHHHTTCCBCEEEEGGGTEEEECC--------------EEEECSEEECTTCCHHHHHHHTTHHH
T ss_pred             CCCCeEEEEEeCCCChhhhccCCceEEEEcCCCCEEEEeeccccccccccCCCceEeeCCEEECCCcchhHHHHHHHHHH
Confidence            46799999999999999976 66677887765555544331          25789999999999999999999999999


Q ss_pred             HhhhhCCCceeEeeeeccCCCCceecCCCCCCCchHhhhhhccccccC----ccceEEEEEEEEEE---EEecCC--CCc
Q psy17370        165 LDAAFNGYNVCLFAYGQTGSGKSYRGDSTLNSSVLRPRVLFYPGFSWS----HSGWTGWVSCVVVI---AVDFGC--GSW  235 (262)
Q Consensus       165 v~~~l~G~n~~ifaYG~tgSGKTyTm~G~~~~~Giipr~~~~lf~~~~----~~~~~~~vS~~EIy---l~Dll~--~~l  235 (262)
                      |+.+|+|||+||||||||||||||||+|+.+++|||||++++||..++    ...|.+++||+|||   |+|||.  .+|
T Consensus        82 v~~~l~G~n~tifAYGqTGSGKTyTm~G~~~~~Giipr~~~~lF~~i~~~~~~~~~~v~vS~~EIYnE~i~DLL~~~~~l  161 (350)
T 2vvg_A           82 IDAVLEGFNSTIFAYGQTGAGKTWTMGGNKEEPGAIPNSFKHLFDAINSSSSNQNFLVIGSYLELYNEEIRDLIKNNTKL  161 (350)
T ss_dssp             HHHHHTTCCEEEEEECSTTSSHHHHHTBCSSSBCHHHHHHHHHHHHHHTCCTTEEEEEEEEEEEEETTEEEETTTTEEEE
T ss_pred             HHHHhCCCceeEEeecCCCCCCCEEeecCCccCchHHHHHHHHHHHHHhhccCCcEEEEEEEEEEeCCEEEEcccCCcCc
Confidence            999999999999999999999999999999999999999999999875    35899999999999   999996  568


Q ss_pred             eeeecCCCcEEEcCceEEecCChhhhC
Q psy17370        236 RFESKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       236 ~i~ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                      +|+||+.+++||.|++++.|.+.+|++
T Consensus       162 ~i~e~~~~~~~v~gl~~~~v~s~~e~~  188 (350)
T 2vvg_A          162 PLKEDKTRGIYVDGLSMHRVTTAAELS  188 (350)
T ss_dssp             CEEEETTTEEEETTCCCEEESSHHHHH
T ss_pred             eeeEcCCCCEEecCCEEEEcCCHHHHH
Confidence            999999999999999999999999974



>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>4etp_B Spindle POLE BODY-associated protein VIK1; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 262
d1v8ka_ 362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 5e-19
d1goja_ 354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 2e-17
d1sdma_ 364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 1e-16
d1ry6a_ 330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 2e-15
d2ncda_ 368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 2e-15
d1bg2a_ 323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 3e-15
d1x88a1 345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 7e-14
d2zfia1 349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 9e-13
d1f9va_ 342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 1e-10
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif2c [TaxId: 10090]
 Score = 83.0 bits (204), Expect = 5e-19
 Identities = 38/188 (20%), Positives = 63/188 (33%), Gaps = 18/188 (9%)

Query: 74  IKLPRANLIMRSSSENCVADNLECSRMTVAVRIRPLLVKELHM---------DVSSIEIS 124
           IK  R  +     +     D +E  R+ V VR RPL  +EL               + + 
Sbjct: 9   IKEFRVTMECSPLTVT---DPIEEHRICVCVRKRPLNKQELAKKEIDVISVPSKCLLLVH 65

Query: 125 PDRREMKVNDNAKSYTFKLDHCLGQDTDQTSVFTIIAQPLLDAAFNGYNVCLFAYGQTGS 184
             + ++ +    ++  F  D    +      V+   A+PL+   F G     FAYGQTGS
Sbjct: 66  EPKLKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGS 125

Query: 185 GKSY------RGDSTLNSSVLRPRVLFYPGFSWSHSGWTGWVSCVVVIAVDFGCGSWRFE 238
           GK++       G S   S  +            +   +      V V   +   G     
Sbjct: 126 GKTHTMGGDLSGKSQNASKGIYAMASRDVFLLKNQPRYRNLNLEVYVTFFEIYNGKVFDL 185

Query: 239 SKPSHEIY 246
                ++ 
Sbjct: 186 LNKKAKLR 193


>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query262
d1v8ka_ 362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1sdma_ 364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d2zfia1 349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1bg2a_ 323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1x88a1 345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d1ry6a_ 330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d2ncda_ 368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1f9va_ 342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.04
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 92.6
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.32
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 88.97
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 87.03
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 86.46
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 85.36
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 84.69
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 84.57
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 84.09
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 84.01
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 83.31
d1okkd2 207 GTPase domain of the signal recognition particle r 82.77
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 82.45
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 82.45
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 81.24
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 81.1
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 80.99
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 80.99
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 80.01
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif2c [TaxId: 10090]
Probab=100.00  E-value=1.4e-41  Score=311.72  Aligned_cols=167  Identities=22%  Similarity=0.246  Sum_probs=145.0

Q ss_pred             CCCCeEEEEEeCCCCccccC-CCcceEEEcCCceEEEEcCC-C-------CceeeeeceeeCCCCCcchhhcccchhhHh
Q psy17370         96 ECSRMTVAVRIRPLLVKELH-MDVSSIEISPDRREMKVNDN-A-------KSYTFKLDHCLGQDTDQTSVFTIIAQPLLD  166 (262)
Q Consensus        96 ~~~~IkV~vRiRP~~~~E~~-~~~~~i~~~~~~~~i~~~~~-~-------~~~~f~FD~vf~~~~~q~~vy~~~~~plv~  166 (262)
                      ++++|+|+||+||++..|.. ++..+|.+.++...+...+. .       ..+.|+||+||+++++|++||+.++.|+|+
T Consensus        28 ~~~~I~V~vRvRPl~~~E~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~f~FD~vf~~~~~Q~~Vy~~~~~plv~  107 (362)
T d1v8ka_          28 EEHRICVCVRKRPLNKQELAKKEIDVISVPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQ  107 (362)
T ss_dssp             SCCCEEEEEEECCCCHHHHHTTCCBCEECCSSSEEEEEEEEECTTCCEEEEEEEEECSEEECTTCCHHHHHHHTTHHHHH
T ss_pred             CCCCEEEEEEeCCCChHHhhCCCceEEEECCCcEEEEeCCccccccccCcCceeEeCCeecCCCCCHHHHHHHHHHHHHH
Confidence            46789999999999999876 66677777665544433211 1       457899999999999999999999999999


Q ss_pred             hhhCCCceeEeeeeccCCCCceecCCCC------CCCchHhhhhhccccccCc-----cceEEEEEEEEEE---EEecCC
Q psy17370        167 AAFNGYNVCLFAYGQTGSGKSYRGDSTL------NSSVLRPRVLFYPGFSWSH-----SGWTGWVSCVVVI---AVDFGC  232 (262)
Q Consensus       167 ~~l~G~n~~ifaYG~tgSGKTyTm~G~~------~~~Giipr~~~~lf~~~~~-----~~~~~~vS~~EIy---l~Dll~  232 (262)
                      .+|+|+|+||||||||||||||||+|+.      .++||+||++++||..+++     ..|.|++||+|||   ++|||.
T Consensus       108 ~~l~G~n~tifaYGqTGSGKTyTm~G~~~~~~~~~~~Giipr~~~~lf~~~~~~~~~~~~~~v~vS~~EIyne~i~DLL~  187 (362)
T d1v8ka_         108 TIFEGGKATCFAYGQTGSGKTHTMGGDLSGKSQNASKGIYAMASRDVFLLKNQPRYRNLNLEVYVTFFEIYNGKVFDLLN  187 (362)
T ss_dssp             HHHTTCEEEEEEEESTTSSHHHHHHCBC----CBGGGSHHHHHHHHHHHHHTSHHHHTTCCEEEEEEEEEETTEEEETTT
T ss_pred             HHHhccCceEEeeccCCCCCceeeeecCCCCcccccCCeeeehhhhHHHHhhcccccccchhheeeeeeecCCeEEeccc
Confidence            9999999999999999999999999975      3689999999999987764     3799999999999   999995


Q ss_pred             --CCceeeecCCCcEEEcCceEEecCChhhhC
Q psy17370        233 --GSWRFESKPSHEIYLSVSVLTDITKFIEVY  262 (262)
Q Consensus       233 --~~l~i~ed~~~~v~v~gl~~~~V~s~~e~l  262 (262)
                        ..+.++++..+++++.|++++.|.+.+|++
T Consensus       188 ~~~~~~~~~~~~~~~~v~gl~e~~v~s~~e~~  219 (362)
T d1v8ka_         188 KKAKLRVLEDSRQQVQVVGLQEYLVTCADDVI  219 (362)
T ss_dssp             TTEEEEEEECSSCCEEEETCCCEEESSHHHHH
T ss_pred             CCccccccccccCCcccCCCEEEEecCHHHHH
Confidence              556888999999999999999999999974



>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure