Diaphorina citri psyllid: psy17378


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MKIRINKTKGKFSFAMVRGEVLEDMLNRRSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEVNSYARLL
ccCEECcccccEEEEEEEcHHHHHHcccccccccHHHHHHHccccccEEEEEccccEEEEEEEccccccccEEEEccccccccccEEccccccccccccEEEccccccEEcccccccccccccECccccEEEccccccccEEEEEEccccccccEEEEccccccccccEEccccccccccc
*******TKGKFSFAMVRGEVLEDMLNRRSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEVNSYARLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIRINKTKGKFSFAMVRGEVLEDMLNRRSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEVNSYARLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003824 [MF]catalytic activityprobableGO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K8Q, chain A
Confidence level:very confident
Coverage over the Query: 30-166
View the alignment between query and template
View the model in PyMOL
Template: 3J20, chain A
Confidence level:probable
Coverage over the Query: 8-65
View the alignment between query and template
View the model in PyMOL