Psyllid ID: psy17378

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MKIRINKTKGKFSFAMVRGEVLEDMLNRRSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEVNSYARLL
ccEEEEcccccEEEEEEEcHHHHHHcccccccccHHHHHHHccccccEEEEEccccEEEEEEEccccccccEEEEccccccccccEEccccccccccccEEEccccccEEcccccccccccccEEccccEEEccccccccEEEEEEccccccccEEEEccccccccccEEccccccccccc
ccccEccccccEEEEEccHHHHHHccccccccccHHHHHHHcccccEEEEEEEcccEEEEEEEcccccccEEEEEcccccccccEEEccccccHHHHHHHHHccccccHHccccccccHHHHHHcccccEEEEEEEcccEEEEEEEccccccccEEEEEccccccccEEEEcccccHHHHc
mkirinktkgkfSFAMVRGEVLEDMLnrrsfttlkpeiisfwgypseehkvqtedgyiltnfrmpnpggypiimfhglsvssdcwllrnpkedfgksdfivkegSLLDVFEGFISffqpeiisfwgypseehkvqtedgyiltnfrmpnpggypiimfhglsvssdcwllRYEVNSYARLL
mkirinktkgkfsfamVRGEVLEDMLNRRSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEVNSYARLL
MKIRINKTKGKFSFAMVRGEVLEDMLNRRSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEVNSYARLL
**********KFSFAMVRGEVLEDMLNRRSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEVNSYA***
*******TKGKFSFAMVRGEV*******RSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEVNSYARLL
MKIRINKTKGKFSFAMVRGEVLEDMLNRRSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEVNSYARLL
*KIRINKTKGKFSFAMVRGEVLEDMLNRRSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEVNSYARLL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIRINKTKGKFSFAMVRGEVLEDMLNRRSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEVNSYARLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query181 2.2.26 [Sep-21-2011]
Q8BM14 398 Lipase member K OS=Mus mu yes N/A 0.519 0.236 0.339 3e-08
Q9CPP7 395 Gastric triacylglycerol l no N/A 0.502 0.230 0.321 6e-08
Q5VXJ0 399 Lipase member K OS=Homo s yes N/A 0.342 0.155 0.428 9e-08
Q29458 397 Gastric triacylglycerol l yes N/A 0.502 0.229 0.330 1e-07
P07098 398 Gastric triacylglycerol l no N/A 0.502 0.228 0.312 2e-07
P04634 395 Gastric triacylglycerol l no N/A 0.502 0.230 0.294 3e-07
Q71DJ5 393 Triacylglycerol lipase 1 yes N/A 0.392 0.180 0.355 7e-07
P80035 398 Gastric triacylglycerol l yes N/A 0.502 0.228 0.312 8e-07
Q4R4S5 399 Lysosomal acid lipase/cho N/A N/A 0.397 0.180 0.392 1e-06
P38571 399 Lysosomal acid lipase/cho no N/A 0.397 0.180 0.392 1e-06
>sp|Q8BM14|LIPK_MOUSE Lipase member K OS=Mus musculus GN=Lipk PE=2 SV=1 Back     alignment and function desciption
 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 56/112 (50%), Gaps = 18/112 (16%)

Query: 78  LSVSSDCWLLRNPKEDFGKSDFIVKEGSLLDVFEGFISFFQPEIISFWGYPSEEHKVQTE 137
           L  ++ C LL  P + + +      E ++       IS    E+IS+WGYP E+H V TE
Sbjct: 4   LLATTCCVLLSGPIDGYKQESITNPEANM------NIS----ELISYWGYPYEKHDVITE 53

Query: 138 DGYILTNFRMPNPGGYP--------IIMFHGLSVSSDCWLLRYEVNSYARLL 181
           DGYIL  +R+P+  G          + + HGL  S++ W+     NS A LL
Sbjct: 54  DGYILGTYRIPHGKGCSRKTAPKAVVYLQHGLIASANNWICNLPNNSLAFLL 105
Plays a highly specific role in the last step of keratinocyte differentiation. May have an essential function in lipid metabolism of the most differentiated epidermal layers.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9CPP7|LIPG_MOUSE Gastric triacylglycerol lipase OS=Mus musculus GN=Lipf PE=2 SV=1 Back     alignment and function description
>sp|Q5VXJ0|LIPK_HUMAN Lipase member K OS=Homo sapiens GN=LIPK PE=2 SV=2 Back     alignment and function description
>sp|Q29458|LIPG_BOVIN Gastric triacylglycerol lipase OS=Bos taurus GN=LIPF PE=1 SV=1 Back     alignment and function description
>sp|P07098|LIPG_HUMAN Gastric triacylglycerol lipase OS=Homo sapiens GN=LIPF PE=1 SV=1 Back     alignment and function description
>sp|P04634|LIPG_RAT Gastric triacylglycerol lipase OS=Rattus norvegicus GN=Lipf PE=2 SV=1 Back     alignment and function description
>sp|Q71DJ5|LIP1_ARATH Triacylglycerol lipase 1 OS=Arabidopsis thaliana GN=LIP1 PE=1 SV=1 Back     alignment and function description
>sp|P80035|LIPG_CANFA Gastric triacylglycerol lipase OS=Canis familiaris GN=LIPF PE=1 SV=2 Back     alignment and function description
>sp|Q4R4S5|LICH_MACFA Lysosomal acid lipase/cholesteryl ester hydrolase OS=Macaca fascicularis GN=LIPA PE=2 SV=1 Back     alignment and function description
>sp|P38571|LICH_HUMAN Lysosomal acid lipase/cholesteryl ester hydrolase OS=Homo sapiens GN=LIPA PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
195339873 426 GM18549 [Drosophila sechellia] gi|194130 0.519 0.220 0.355 3e-10
195471906 406 GE18470 [Drosophila yakuba] gi|194174344 0.403 0.179 0.392 7e-10
194862251 401 GG23651 [Drosophila erecta] gi|190661825 0.408 0.184 0.394 8e-10
24583472 406 CG18302 [Drosophila melanogaster] gi|729 0.403 0.179 0.379 1e-09
262399423 406 MIP13779p [Drosophila melanogaster] 0.403 0.179 0.379 1e-09
198472737 532 GA16540 [Drosophila pseudoobscura pseudo 0.403 0.137 0.392 1e-09
195161585 532 GL26620 [Drosophila persimilis] gi|19410 0.403 0.137 0.392 1e-09
24583491 531 CG31871 [Drosophila melanogaster] gi|229 0.403 0.137 0.392 1e-09
194862191 533 GG23662 [Drosophila erecta] gi|190661811 0.403 0.136 0.392 1e-09
195578261 406 GD23715 [Drosophila simulans] gi|1941909 0.403 0.179 0.379 1e-09
>gi|195339873|ref|XP_002036541.1| GM18549 [Drosophila sechellia] gi|194130421|gb|EDW52464.1| GM18549 [Drosophila sechellia] Back     alignment and taxonomy information
 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 58/118 (49%), Gaps = 24/118 (20%)

Query: 86  LLRNPKEDFGKSDFIVKEGSLLDVFEGFISFF---QPEIISFWGYPSEEHKVQTEDGYIL 142
           L+R  ++ FG       EGS L      I F    QP++I  +GYP+E HK+Q +DG++L
Sbjct: 28  LIRGGQKYFGGCQSDHGEGSKLSYIVQNIYFLIPTQPDLIKKYGYPAETHKIQAKDGFVL 87

Query: 143 TNFRMPNPGGYPIIMFHGLSVSS---------------------DCWLLRYEVNSYAR 179
           T  R+P PGG P+++ HGL  SS                     D WLL    N Y+R
Sbjct: 88  TAHRIPKPGGQPVLLVHGLLDSSVAYVILGPKKSLGFLLSDLGYDVWLLNTRGNRYSR 145

Source: Drosophila sechellia

Species: Drosophila sechellia

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195471906|ref|XP_002088243.1| GE18470 [Drosophila yakuba] gi|194174344|gb|EDW87955.1| GE18470 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194862251|ref|XP_001969958.1| GG23651 [Drosophila erecta] gi|190661825|gb|EDV59017.1| GG23651 [Drosophila erecta] Back     alignment and taxonomy information
>gi|24583472|ref|NP_609420.1| CG18302 [Drosophila melanogaster] gi|7297722|gb|AAF52973.1| CG18302 [Drosophila melanogaster] gi|371941028|gb|AEX60472.1| FI18410p1 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|262399423|gb|ACY65494.1| MIP13779p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|198472737|ref|XP_001356051.2| GA16540 [Drosophila pseudoobscura pseudoobscura] gi|198139139|gb|EAL33110.2| GA16540 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195161585|ref|XP_002021643.1| GL26620 [Drosophila persimilis] gi|194103443|gb|EDW25486.1| GL26620 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|24583491|ref|NP_723607.1| CG31871 [Drosophila melanogaster] gi|22946191|gb|AAF52985.2| CG31871 [Drosophila melanogaster] gi|28317004|gb|AAO39522.1| RE24765p [Drosophila melanogaster] gi|220948196|gb|ACL86641.1| CG31871-PA [synthetic construct] gi|220957422|gb|ACL91254.1| CG31871-PA [synthetic construct] Back     alignment and taxonomy information
>gi|194862191|ref|XP_001969944.1| GG23662 [Drosophila erecta] gi|190661811|gb|EDV59003.1| GG23662 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195578261|ref|XP_002078984.1| GD23715 [Drosophila simulans] gi|194190993|gb|EDX04569.1| GD23715 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
FB|FBgn0032266 406 CG18302 [Drosophila melanogast 0.342 0.152 0.419 2e-13
FB|FBgn0032264 434 Lip4 "Lipase 4" [Drosophila me 0.320 0.133 0.431 1.9e-11
FB|FBgn0032265 422 CG18301 [Drosophila melanogast 0.480 0.206 0.361 5e-11
FB|FBgn0051871 531 CG31871 [Drosophila melanogast 0.386 0.131 0.430 9.9e-11
RGD|1309724 402 Lipk "lipase, family member K" 0.375 0.169 0.447 7.2e-10
UNIPROTKB|E2QSL3 405 LIPK "Uncharacterized protein" 0.513 0.229 0.364 3.3e-09
UNIPROTKB|F1SCY4 399 LIPA "Lipase" [Sus scrofa (tax 0.397 0.180 0.428 6.8e-09
FB|FBgn0036996 399 mag "magro" [Drosophila melano 0.425 0.192 0.406 8.7e-09
UNIPROTKB|F5H6K2136 LIPA "Lysosomal acid lipase/ch 0.397 0.529 0.392 1.2e-08
MGI|MGI:1914967 395 Lipf "lipase, gastric" [Mus mu 0.502 0.230 0.321 1.4e-08
FB|FBgn0032266 CG18302 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 165 (63.1 bits), Expect = 2.0e-13, Sum P(2) = 2.0e-13
 Identities = 26/62 (41%), Positives = 43/62 (69%)

Query:    34 LKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRNPKED 93
             + P++I  +GYP+E HK+Q +DG++LT  R+P PGG P+++ HGL  SS  +++  P+  
Sbjct:    42 ITPDLIKKYGYPAETHKIQAKDGFVLTAHRIPKPGGQPVLLVHGLLDSSVAYVILGPERS 101

Query:    94 FG 95
              G
Sbjct:   102 LG 103
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=IEA
GO:0006629 "lipid metabolic process" evidence=IEA
FB|FBgn0032264 Lip4 "Lipase 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032265 CG18301 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051871 CG31871 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1309724 Lipk "lipase, family member K" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSL3 LIPK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCY4 LIPA "Lipase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0036996 mag "magro" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F5H6K2 LIPA "Lysosomal acid lipase/cholesteryl ester hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914967 Lipf "lipase, gastric" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.1LOW CONFIDENCE prediction!
3rd Layer3.1.1.13LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
pfam0408362 pfam04083, Abhydro_lipase, Partial alpha/beta-hydr 1e-18
pfam0408362 pfam04083, Abhydro_lipase, Partial alpha/beta-hydr 1e-18
PLN02872 395 PLN02872, PLN02872, triacylglycerol lipase 5e-10
PLN02872 395 PLN02872, PLN02872, triacylglycerol lipase 6e-07
>gnl|CDD|217881 pfam04083, Abhydro_lipase, Partial alpha/beta-hydrolase lipase region Back     alignment and domain information 
 Score = 74.9 bits (185), Expect = 1e-18
 Identities = 26/59 (44%), Positives = 34/59 (57%), Gaps = 7/59 (11%)

Query: 36 PEIISFWGYPSEEHKVQTEDGYILTNFRMPNPG-------GYPIIMFHGLSVSSDCWLL 87
           E+I  +GYP EEH+V TEDGYILT  R+P             +++ HGL  SS  W+L
Sbjct: 2  SELIRKYGYPVEEHEVTTEDGYILTLHRIPPGRNNRGRGKKPVVLLQHGLLASSADWVL 60

This family corresponds to a N-terminal part of an alpha/beta hydrolase domain. Length = 62
>gnl|CDD|217881 pfam04083, Abhydro_lipase, Partial alpha/beta-hydrolase lipase region Back     alignment and domain information
>gnl|CDD|215470 PLN02872, PLN02872, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|215470 PLN02872, PLN02872, triacylglycerol lipase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 181
KOG2624|consensus 403 100.0
PLN02872 395 triacylglycerol lipase 99.96
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 99.92
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 99.6
KOG2624|consensus 403 99.37
PLN02872 395 triacylglycerol lipase 98.87
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 97.68
PLN02298 330 hydrolase, alpha/beta fold family protein 97.09
PRK10985 324 putative hydrolase; Provisional 96.82
PLN02385 349 hydrolase; alpha/beta fold family protein 96.72
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 96.69
PRK13604 307 luxD acyl transferase; Provisional 96.54
PRK07868 994 acyl-CoA synthetase; Validated 96.39
PLN02511 388 hydrolase 96.34
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 95.96
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 95.89
TIGR01607 332 PST-A Plasmodium subtelomeric family (PST-A). Thes 95.78
PRK05855 582 short chain dehydrogenase; Validated 95.75
PRK10749 330 lysophospholipase L2; Provisional 95.26
PRK00870 302 haloalkane dehalogenase; Provisional 94.69
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 94.67
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 94.58
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 94.57
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 94.56
PLN02652 395 hydrolase; alpha/beta fold family protein 94.29
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 93.75
PHA02857 276 monoglyceride lipase; Provisional 93.18
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 92.59
KOG1455|consensus 313 92.46
PRK03592 295 haloalkane dehalogenase; Provisional 91.92
PLN02211 273 methyl indole-3-acetate methyltransferase 91.45
PRK05077 414 frsA fermentation/respiration switch protein; Revi 91.05
PLN02824 294 hydrolase, alpha/beta fold family protein 90.36
PF01674 219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 90.31
COG3243 445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 89.54
PRK06489 360 hypothetical protein; Provisional 89.22
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 89.18
PLN02578 354 hydrolase 89.12
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 88.43
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 87.47
KOG4178|consensus 322 87.05
PRK03204 286 haloalkane dehalogenase; Provisional 86.53
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 85.65
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 85.38
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 85.18
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 84.74
COG1647 243 Esterase/lipase [General function prediction only] 83.65
COG0429 345 Predicted hydrolase of the alpha/beta-hydrolase fo 83.32
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 82.61
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 82.53
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 82.49
PRK10566 249 esterase; Provisional 82.49
PF07819 225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 81.54
PRK04057203 30S ribosomal protein S3Ae; Validated 81.1
COG4757 281 Predicted alpha/beta hydrolase [General function p 80.05
>KOG2624|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.1e-41  Score=301.93  Aligned_cols=138  Identities=30%  Similarity=0.507  Sum_probs=125.8

Q ss_pred             CcCCCHHHHHhhcCCceeEEEEecCCCcEEEEEeeCCC--CCCcEEEecccccccccccccCCCCCCCcchhhhhcCCCc
Q psy17378         30 SFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNP--GGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIVKEGSLL  107 (181)
Q Consensus        30 ~~~~~~~~~i~~~gy~~e~h~v~T~DGyiL~l~Ri~~~--~~~pVll~HGl~~ss~~~~~~~~~~sl~~~~~~Lad~~Gy  107 (181)
                      +....+.++|+++|||+|+|.|+|+|||||++||||++  +||||||||||++||+.|++|+|++|||   |+|||+ ||
T Consensus        32 ~~~~~~~~~i~~~gy~~E~h~V~T~DgYiL~lhRIp~~~~~rp~Vll~HGLl~sS~~Wv~n~p~~sLa---f~Lada-GY  107 (403)
T KOG2624|consen   32 ELVMDTPEIIEKYGYPVEEHEVTTEDGYILTLHRIPRGKKKRPVVLLQHGLLASSSSWVLNGPEQSLA---FLLADA-GY  107 (403)
T ss_pred             hhcccHHHHHHHcCCceEEEEEEccCCeEEEEeeecCCCCCCCcEEEeeccccccccceecCccccHH---HHHHHc-CC
Confidence            44466899999999999999999999999999999976  7899999999999999999999999999   999999 99


Q ss_pred             eeeeccc---------eecCcc-chhhhcCCccceeeeCCCcceEEEEecCCCCCCcEEEEeecccccccceecCCC
Q psy17378        108 DVFEGFI---------SFFQPE-IISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSDCWLLRYEV  174 (181)
Q Consensus       108 DVWl~n~---------~~l~~~-~~~~w~ys~de~avyDld~yIl~i~rI~~~~~~~vll~HGl~~~s~~w~~~g~~  174 (181)
                      ||||||.         ++++++ +.+||+|+|+|++.||+||.|+.|...   +++.++.+.|||||++++++....
T Consensus       108 DVWLgN~RGn~ySr~h~~l~~~~~~~FW~FS~~Em~~yDLPA~IdyIL~~---T~~~kl~yvGHSQGtt~~fv~lS~  181 (403)
T KOG2624|consen  108 DVWLGNNRGNTYSRKHKKLSPSSDKEFWDFSWHEMGTYDLPAMIDYILEK---TGQEKLHYVGHSQGTTTFFVMLSE  181 (403)
T ss_pred             ceeeecCcCcccchhhcccCCcCCcceeecchhhhhhcCHHHHHHHHHHh---ccccceEEEEEEccchhheehhcc
Confidence            9999999         556775 888999999999999999999877665   588899999999999988877543

>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>KOG2624|consensus Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>KOG4178|consensus Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PRK04057 30S ribosomal protein S3Ae; Validated Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
1hlg_A 371 Crystal Structure Of Human Gastric Lipase Length = 1e-08
1hlg_A 371 Crystal Structure Of Human Gastric Lipase Length = 4e-08
1k8q_A 377 Crystal Structure Of Dog Gastric Lipase In Complex 8e-08
1k8q_A 377 Crystal Structure Of Dog Gastric Lipase In Complex 3e-07
>pdb|1HLG|A Chain A, Crystal Structure Of Human Gastric Lipase Length = 371 Back     alignment and structure 
Iteration: 1

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 21/112 (18%)
Query: 37  EIISFWGYPSEEHKVQTEDGYILTNFRMP-------NPGGYPIIMF-HGLSVSSDCWLLR 88
           ++I++WGYP+EE++V TEDGYIL   R+P       N G  P++   HGL  S+  W+  
Sbjct: 10  QMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQHGLLASATNWISN 69
Query: 89  NPKEDFGKSDFIVKEGSLLDVFEGFIS---------FFQPEIISFWGYPSEE 131
            P        FI+ +    DV+ G            ++ P+ + FW +  +E
Sbjct: 70  LPNNSLA---FILADAG-YDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDE 117
>pdb|1HLG|A Chain A, Crystal Structure Of Human Gastric Lipase Length = 371 Back     alignment and structure
>pdb|1K8Q|A Chain A, Crystal Structure Of Dog Gastric Lipase In Complex With A Phosphonate Inhibitor Length = 377 Back     alignment and structure
>pdb|1K8Q|A Chain A, Crystal Structure Of Dog Gastric Lipase In Complex With A Phosphonate Inhibitor Length = 377 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 8e-16
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 9e-16
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Length = 377 Back     alignment and structure
 Score = 73.1 bits (179), Expect = 8e-16
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 36 PEIISFWGYPSEEHKVQTEDGYILTNFRMPNP--------GGYPIIMFHGLSVSSDCWLL 87
           ++I++WGYP+EE++V TEDGYIL   R+P                + HGL  S+  W+ 
Sbjct: 17 SQMITYWGYPAEEYEVVTEDGYILGIDRIPYGRKNSENIGRRPVAFLQHGLLASATNWIS 76

Query: 88 RNPKEDFG 95
            P     
Sbjct: 77 NLPNNSLA 84
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Length = 377 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.47
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 97.81
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 97.44
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 97.41
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 97.39
3llc_A 270 Putative hydrolase; structural genomics, joint cen 97.32
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 97.32
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.3
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 97.28
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 97.18
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 97.16
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 97.14
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 97.13
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 97.05
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 97.02
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 97.01
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 96.96
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 96.92
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 96.89
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 96.89
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 96.87
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 96.83
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 96.74
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 96.73
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 96.68
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 96.65
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 96.64
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 96.63
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 95.59
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 96.54
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 96.52
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 96.46
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 96.43
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 96.4
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 96.27
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 96.25
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 96.2
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 96.16
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 96.13
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 96.08
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 96.0
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 95.99
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 95.98
1zi8_A 236 Carboxymethylenebutenolidase; alpha and beta prote 95.94
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 95.86
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 95.79
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 95.77
3f67_A 241 Putative dienelactone hydrolase; alpha-beta-alpha 95.77
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 95.76
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 95.74
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 95.63
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 95.58
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 95.58
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 95.54
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 95.36
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 95.34
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 95.3
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 95.0
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 94.97
1ufo_A 238 Hypothetical protein TT1662; alpha-beta fold, hydr 94.86
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 94.7
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 94.7
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 94.58
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 94.55
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 94.55
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 94.51
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 94.46
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.27
1qlw_A 328 Esterase; anisotropic refinement, atomic resolutio 94.25
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 94.24
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 94.23
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 94.23
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 94.2
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 94.19
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 93.85
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 93.81
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 93.66
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 93.65
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 93.61
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 93.59
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 93.56
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.55
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 93.54
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 93.53
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.51
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 93.48
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 93.36
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 93.32
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 93.3
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 93.29
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 93.24
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 93.07
3h04_A 275 Uncharacterized protein; protein with unknown func 93.07
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 93.02
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 92.99
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 92.9
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 92.89
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 92.87
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 92.86
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 92.86
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 92.86
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 92.69
1iup_A 282 META-cleavage product hydrolase; aromatic compound 92.58
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 92.3
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 92.22
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 92.13
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 92.03
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 91.94
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 91.89
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 91.86
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 91.74
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 91.58
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 91.57
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 91.2
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 90.88
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 90.66
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 90.41
1r3d_A 264 Conserved hypothetical protein VC1974; structural 90.32
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 90.21
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 90.02
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 89.97
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 89.76
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 89.49
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 89.11
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 89.05
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 88.95
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 88.95
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 88.94
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 88.88
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 88.86
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 88.51
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 88.47
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 88.47
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 88.42
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 88.05
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 88.0
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 87.71
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 87.19
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 86.87
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 86.84
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 86.79
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 86.7
2fx5_A 258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 86.47
3j20_A198 30S ribosomal protein S3AE; archaea, archaeal, KIN 85.32
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 84.9
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 84.83
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 84.71
1ycd_A 243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 84.64
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 84.45
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 83.71
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 83.59
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 83.25
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 83.22
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 82.7
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 82.34
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 82.0
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 81.51
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 81.01
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 80.74
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
Probab=99.47  E-value=1.3e-14  Score=119.97  Aligned_cols=130  Identities=28%  Similarity=0.479  Sum_probs=99.0

Q ss_pred             CcCCCHHHHHhhcCCceeEEEEecCCCcEEEEEeeCCC--------CCCcEEEecccccccccccccCCCCCCCcchhhh
Q psy17378         30 SFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNP--------GGYPIIMFHGLSVSSDCWLLRNPKEDFGKSDFIV  101 (181)
Q Consensus        30 ~~~~~~~~~i~~~gy~~e~h~v~T~DGyiL~l~Ri~~~--------~~~pVll~HGl~~ss~~~~~~~~~~sl~~~~~~L  101 (181)
                      +....+.++++.+||+.|++.++|.||+.|..++++++        +++||+|+||+.+++..|....+..+++   ..|
T Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~~~dG~~l~~~~~~~~~~~~~~~~~~~~vvl~HG~~~~~~~~~~~~~~~~~a---~~l   87 (377)
T 1k8q_A           11 EVTMNISQMITYWGYPAEEYEVVTEDGYILGIDRIPYGRKNSENIGRRPVAFLQHGLLASATNWISNLPNNSLA---FIL   87 (377)
T ss_dssp             GGGCCHHHHHHHTTCCCEEEEEECTTSEEEEEEEECSCSSCCTTTTTCCEEEEECCTTCCGGGGSSSCTTTCHH---HHH
T ss_pred             ccccCHHHHHHHcCCCceEEEeEcCCCCEEEEEEecCCCCCccccCCCCeEEEECCCCCchhhhhcCCCcccHH---HHH
Confidence            33456899999999999999999999999999999643        5789999999999999998776667788   899


Q ss_pred             hcCCCceeeeccceec--C-------ccchhhhcCCccceeeeCCCcceEEEEecCCCCCCcEEEEeecccccc
Q psy17378        102 KEGSLLDVFEGFISFF--Q-------PEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSD  166 (181)
Q Consensus       102 ad~~GyDVWl~n~~~l--~-------~~~~~~w~ys~de~avyDld~yIl~i~rI~~~~~~~vll~HGl~~~s~  166 (181)
                      +++ ||+|+..+..+.  +       +....+|.|++++++.+|+.+.+..+....  ...+ +...|+|.|+.
T Consensus        88 ~~~-G~~vi~~D~~G~G~S~~~~~~~~~~~~~~~~~~~~~~~~D~~~~i~~~~~~~--~~~~-~~lvG~S~Gg~  157 (377)
T 1k8q_A           88 ADA-GYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFILKKT--GQDK-LHYVGHSQGTT  157 (377)
T ss_dssp             HHT-TCEEEECCCTTSTTSCEESSSCTTSTTTTCCCHHHHHHTHHHHHHHHHHHHH--CCSC-EEEEEETHHHH
T ss_pred             HHC-CCCEEEecCCCCCCCCCCCCCCCCcccccCccHHHHHhhhHHHHHHHHHHhc--CcCc-eEEEEechhhH
Confidence            999 999999998322  2       344567899999988778877664332211  1122 33446666654
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3j20_A 30S ribosomal protein S3AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 181
d1k8qa_ 377 c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari 1e-16
d1k8qa_ 377 c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari 7e-16
d1azwa_ 313 c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas 0.002
d1wm1a_ 313 c.69.1.7 (A:) Proline aminopeptidase {Serratia mar 0.002
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Gastric lipase
domain: Gastric lipase
species: Dog (Canis familiaris) [TaxId: 9615]

 Score = 74.4 bits (181), Expect = 1e-16
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 8/71 (11%)

Query: 119 PEIISFWGYPSEEHKVQTEDGYILTNFRMPNP--------GGYPIIMFHGLSVSSDCWLL 170
            ++I++WGYP+EE++V TEDGYIL   R+P                + HGL  S+  W+ 
Sbjct: 17  SQMITYWGYPAEEYEVVTEDGYILGIDRIPYGRKNSENIGRRPVAFLQHGLLASATNWIS 76

Query: 171 RYEVNSYARLL 181
               NS A +L
Sbjct: 77  NLPNNSLAFIL 87
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377 Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Length = 313 Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.92
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 98.67
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.37
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 98.15
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.06
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 98.0
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 97.89
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 97.71
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 97.69
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 97.66
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 97.36
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 97.34
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 97.25
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 97.04
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 96.91
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 96.64
d1qlwa_ 318 A novel bacterial esterase {Alcaligenes sp. [TaxId 96.55
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 96.48
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 96.47
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 96.36
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 96.31
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 96.26
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 96.0
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 96.0
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 95.99
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 95.96
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 95.83
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 95.78
d1ufoa_ 238 Hypothetical protein TT1662 {Thermus thermophilus 95.68
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 95.59
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 95.52
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 94.76
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 94.63
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 94.22
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 94.08
d1qo7a_ 394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 93.96
d1dqza_ 280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 92.97
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 92.49
d1r88a_ 267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 91.93
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 91.93
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 91.2
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 91.14
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 89.19
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 88.99
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 88.75
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 88.66
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 87.43
d1sfra_ 288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 85.05
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 84.91
d1dina_ 233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 82.91
d1qfma2 280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 82.64
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 82.14
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 81.01
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 80.95
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Gastric lipase
domain: Gastric lipase
species: Dog (Canis familiaris) [TaxId: 9615]

Probab=99.92  E-value=1.9e-26  Score=189.06  Aligned_cols=133  Identities=28%  Similarity=0.483  Sum_probs=110.4

Q ss_pred             cCCCcCCCHHHHHhhcCCceeEEEEecCCCcEEEEEeeCCC--------CCCcEEEecccccccccccccCCCCCCCcch
Q psy17378         27 NRRSFTTLKPEIISFWGYPSEEHKVQTEDGYILTNFRMPNP--------GGYPIIMFHGLSVSSDCWLLRNPKEDFGKSD   98 (181)
Q Consensus        27 ~~~~~~~~~~~~i~~~gy~~e~h~v~T~DGyiL~l~Ri~~~--------~~~pVll~HGl~~ss~~~~~~~~~~sl~~~~   98 (181)
                      ++|...+.++|+|+.+|||.|+|.|+|+|||.|++|||+.+        +||||||+||+.+|+..|..+.+..||+   
T Consensus         8 ~~~~~~~~~~~~~~~~~y~~e~h~v~t~DG~~l~~~ri~~~~~~~~~~~~~~~vlllHG~~~~~~~~~~~~~~~sla---   84 (377)
T d1k8qa_           8 TNPEVTMNISQMITYWGYPAEEYEVVTEDGYILGIDRIPYGRKNSENIGRRPVAFLQHGLLASATNWISNLPNNSLA---   84 (377)
T ss_dssp             CCGGGGCCHHHHHHHTTCCCEEEEEECTTSEEEEEEEECSCSSCCTTTTTCCEEEEECCTTCCGGGGSSSCTTTCHH---
T ss_pred             CCCCcCCCHHHHHHHcCCCceEEEEEcCCCCEEEEEEecCCCCCCccCCCCCeEEEECCCccchhHHhhcCccchHH---
Confidence            34567778999999999999999999999999999999743        5789999999999999999999889999   


Q ss_pred             hhhhcCCCceeeecccee--c-------CccchhhhcCCccceeeeCCCcceEEEEecCCCCCCcEEEEeecccccc
Q psy17378         99 FIVKEGSLLDVFEGFISF--F-------QPEIISFWGYPSEEHKVQTEDGYILTNFRMPNPGGYPIIMFHGLSVSSD  166 (181)
Q Consensus        99 ~~Lad~~GyDVWl~n~~~--l-------~~~~~~~w~ys~de~avyDld~yIl~i~rI~~~~~~~vll~HGl~~~s~  166 (181)
                      ..|+++ |||||+.|+++  .       .+...+++.+++++++++|+++.|..+...   .+...+...|+|.|+.
T Consensus        85 ~~L~~~-Gy~V~~~D~rG~G~S~~~~~~~~~~~~~~~~~~~~~~~~Dl~~~i~~i~~~---~g~~~v~lvGhS~GG~  157 (377)
T d1k8qa_          85 FILADA-GYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFILKK---TGQDKLHYVGHSQGTT  157 (377)
T ss_dssp             HHHHHT-TCEEEECCCTTSTTSCEESSSCTTSTTTTCCCHHHHHHTHHHHHHHHHHHH---HCCSCEEEEEETHHHH
T ss_pred             HHHHHC-CCEEEEEcCCCCCCCCCCCCCCCcchhhccCCHHHHhhhhHHHHHHHHHHH---cCCCCEEEEEecchHH
Confidence            999999 99999999932  2       223568899999999999999988766554   2223344568888764
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure