Diaphorina citri psyllid: psy1741

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---
MGHALLKGILDSLKGIIIIFRLDNKLKERSELKRKKKEFESPSHQKTQSSSVPEELKRKKKEFESPSHQKTQSSSVPEENKVWKRTVQCCLLNGGVFCGSILLFDHILLPFLLMILRLILGSSSTYTQFYWTWINLVLSWTFNALWVLPLFTLSKVINSLWFQDIADSAYRYTQGRPHHFTSLSKLLADTLFSLLIQSLFLVQTMLVSKLPLYLLSDSIGLIHMCLLYSLYAYEYKWYNQGWELHRRLTFIEHNFPYFLGFGLTLAVLTHVCSSYVIRQDILKTSSLFHLLFIILLLCCSEYQLKLFSPVIAISNAVFNHTIRPAQVKQPARR
cHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHcccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccc
*GHALLKGILDSLKGIIIIFRLDN********************************************************KVWKRTVQCCLLNGGVFCGSILLFDHILLPFLLMILRLILGSSSTYTQFYWTWINLVLSWTFNALWVLPLFTLSKVINSLWFQDIADSAYRYTQGRPHHFTSLSKLLADTLFSLLIQSLFLVQTMLVSKLPLYLLSDSIGLIHMCLLYSLYAYEYKWYNQGWELHRRLTFIEHNFPYFLGFGLTLAVLTHVCSSYVIRQDILKTSSLFHLLFIILLLCCSEYQLKLFSPVIAISNAVFNHTIR**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGHALLKGILDSLKGIIIIFRLDNKLKERSELKRKKKEFESPSHQKTQSSSVPEELKRKKKEFESPSHQKTQSSSVPEENKVWKRTVQCCLLNGGVFCGSILLFDHILLPFLLMILRLILGSSSTYTQFYWTWINLVLSWTFNALWVLPLFTLSKVINSLWFQDIADSAYRYTQGRPHHFTSLSKLLADTLFSLLIQSLFLVQTMLVSKLPLYLLSDSIGLIHMCLLYSLYAYEYKWYNQGWELHRRLTFIEHNFPYFLGFGLTLAVLTHVCSSYVIRQDILKTSSLFHLLFIILLLCCSEYQLKLFSPVIAISNAVFNHTIRPAQVKQPARR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Etoposide-induced protein 2.4 homolog Acts as a negative growth regulator via p53-mediated apoptosis pathway. Regulates formation of degradative autolysosomes during autophagy.confidentO14681
Etoposide-induced protein 2.4 homolog confidentQ08DE5
Etoposide-induced protein 2.4 Acts as a negative growth regulator via p53-mediated apoptosis pathway. Regulates formation of degradative autolysosomes during autophagy.confidentQ61070

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030308 [BP]negative regulation of cell growthprobableGO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TX3, chain A
Confidence level:confident
Coverage over the Query: 78-111,135-272
View the alignment between query and template
View the model in PyMOL