Diaphorina citri psyllid: psy17422

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510--
LWGDHGQAALESARICLINATGLGTEILKSLVLPGVGSFTIIDGEKISEQDLGTNFFLDVDSIGKSRAEVATQLLLELNPDCQGDFVDENPQVLMANDPNFFQSFHMVISTNCPILSLPSFFLDVDSIGKSRAEVATQLLLELNPDCQGDFVDENPQVLMANDPNFFQSFHMVISTNLPETTLIELSKTLWSLNIPLLACRSYGFIGSIRLQISEHTIIESHPDNTNPDLRLDKPWPSLIQYVDSIDLDSLEVKDHMHIPYLVILYKYLKLWQSQNNTQDLPKNYKEKQNLRELIRSGIRKDENGIPLSEENFEEAMKAVNFALIPTTVPSSVARIRKDENGIPLSEENFEEAMKAVNFALIPTTVPSSVASILNDNACVNLTSKSEPFWILAKAVKDFVDNEGNGNLPLRGSLPDMTADTTRYIALQQLYRDQAGRDADVIYRRAQQLLHQLGQPSSAITEAQVKLFCRNASFIHVNESKLVLKLCDFGSASWSHENEITPYLVSRFYRAP
cccHHHHHHHHcccEEEEcccccHHHHHHHHccccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHHcccccCEEECccccccccccccccccccEEEECcccccccccEEECccccccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEEEEEEEccccCEEEcccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccEEEEccHHHHHHccccccccccccHHHHHHHHHcccc
LWGDHG*AALESARICLINATGLGTEILKSLVLPGVGSFTIIDGEKISEQDLGTNFFLDVDSIGKSRAEVATQLLLELNPDCQGDFVDENPQVLMANDPNFFQSFHMVISTNCPILSLPSFFLDVDSIGKSRAEVATQLLLELNPDCQGDFVDENPQVLMANDPNFFQSFHMVISTNLPETTLIELSKTLWSLNIPLLACRSYGFIGSIRLQISEHTIIESHPDNTNPDLRLDKPWPSLIQYVDSIDLDSLEVKDHMHIPYLVILYKYLKLWQSQNNTQDLPKNYKEKQNLRELIRS*************ENFEEAMKAVNFALIPTTVPSSVARIRKDENGIPLSEENFEEAMKAVNFALIPTTVPSSVASILNDNACVNLTSKSEPFWILAKAVKDFVDNEGNGNLPLRGSLPDMTADTTRYIALQQLYRDQAGRDADVIYRRAQQLLHQLGQPSSAITEAQVKLFCRNASFIHVNESKLVLKLCDFGSASWSHENEITPYLVSRFYRAP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LWGDHGQAALESARICLINATGLGTEILKSLVLPGVGSFTIIDGEKISEQDLGTNFFLDVDSIGKSRAEVATQLLLELNPDCQGDFVDENPQVLMANDPNFFQSFHMVISTNCPILSLPSFFLDVDSIGKSRAEVATQLLLELNPDCQGDFVDENPQVLMANDPNFFQSFHMVISTNLPETTLIELSKTLWSLNIPLLACRSYGFIGSIRLQISEHTIIESHPDNTNPDLRLDKPWPSLIQYVDSIDLDSLEVKDHMHIPYLVILYKYLKLWQSQNNTQDLPKNYKEKQNLRELIRSGIRKDENGIPLSEENFEEAMKAVNFALIPTTVPSSVARIRKDENGIPLSEENFEEAMKAVNFALIPTTVPSSVASILNDNACVNLTSKSEPFWILAKAVKDFVDNEGNGNLPLRGSLPDMTADTTRYIALQQLYRDQAGRDADVIYRRAQQLLHQLGQPSSAITEAQVKLFCRNASFIHVNESKLVLKLCDFGSASWSHENEITPYLVSRFYRAP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NEDD8-activating enzyme E1 regulatory subunit Regulatory subunit of the dimeric uba3-nae1 E1 enzyme. E1 activates nedd8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a nedd8-uba3 thioester and free AMP. E1 finally transfers nedd8 to the catalytic cysteine of ube2m.confidentQ7SXP2
NEDD8-activating enzyme E1 regulatory subunit Regulatory subunit of the dimeric uba-3-ula-1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-Uba-3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of ubc-12.confidentQ18217
NEDD8-activating enzyme E1 regulatory subunit Regulatory subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Necessary for cell cycle progression through the S-M checkpoint. Overexpression of NAE1 causes apoptosis through deregulation of NEDD8 conjugation.confidentQ8VBW6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0033314 [BP]mitotic DNA replication checkpointprobableGO:0007346, GO:0000076, GO:0000075, GO:0051726, GO:0008150, GO:0010564, GO:0050794, GO:0048523, GO:1901987, GO:0010948, GO:0065007, GO:1901991, GO:1901990, GO:0048519, GO:0044774, GO:0007093, GO:0050789, GO:1901988, GO:0031570
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0019781 [MF]NEDD8 activating enzyme activityprobableGO:0003824, GO:0003674, GO:0008641
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0006260 [BP]DNA replicationprobableGO:0071704, GO:1901576, GO:0044238, GO:0008152, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0044249, GO:0009058, GO:0009059, GO:0006807, GO:0034645, GO:0006259, GO:0008150, GO:1901360, GO:0046483

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TT5, chain A
Confidence level:very confident
Coverage over the Query: 1-92,158-313,351-483
View the alignment between query and template
View the model in PyMOL
Template: 3CMM, chain A
Confidence level:very confident
Coverage over the Query: 1-92,164-361
View the alignment between query and template
View the model in PyMOL
Template: 1YOV, chain A
Confidence level:very confident
Coverage over the Query: 120-331,369-510
View the alignment between query and template
View the model in PyMOL
Template: 4EZB, chain A
Confidence level:probable
Coverage over the Query: 13-52,66-116,133-141,158-202
View the alignment between query and template
View the model in PyMOL