Diaphorina citri psyllid: psy17456

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MYAYVDQMQFAGRDLVSALRYFLEGFRLPGEAQKIDRLMEKFASRYCENNPNVGLQNCDDTEIASLCLEGIRCAIRIACIFHLTLERNAYVQALARFTLLTANSPITEMKAKNIETIKTLINVAHTDDTAYVLAYSIIMLTTDLHSPQVKSKMTKEQYIRLNRGISDSQDLPEAYLSKIYDEIADQEIKMKSANKPGKQKSPV
cHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccc
MYAYVDQMQFAGRDLVSALRYFLEGFRLPGEAQKIDRLMEKFASRYCENNPNVGLQNCDDTEIASLCLEGIRCAIRIACIFHLTLERNAYVQALARFTLLTANSPITEMKAKNIETIKTLINVAHTDDTAYVLAYSIIMLTTDLHSPQVKSKMTKEQYIRLNRGISDSQDLPEAYLSKIYDEIADQ*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYAYVDQMQFAGRDLVSALRYFLEGFRLPGEAQKIDRLMEKFASRYCENNPNVGLQNCDDTEIASLCLEGIRCAIRIACIFHLTLERNAYVQALARFTLLTANSPITEMKAKNIETIKTLINVAHTDDTAYVLAYSIIMLTTDLHSPQVKSKMTKEQYIRLNRGISDSQDLPEAYLSKIYDEIADQEIKMKSANKPGKQKSPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005879 [CC]axonemal microtubuleprobableGO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005856, GO:0005575, GO:0005874, GO:0044430, GO:0015630, GO:0042995, GO:0005930, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044447, GO:0044424, GO:0044422
GO:0032280 [CC]symmetric synapseprobableGO:0005575, GO:0045202
GO:0001881 [BP]receptor recyclingprobableGO:0044260, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0065007, GO:0008152, GO:0023051, GO:0008150, GO:0043112, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034237 [MF]protein kinase A regulatory subunit bindingprobableGO:0051018, GO:0003674, GO:0005488, GO:0005515
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0005815 [CC]microtubule organizing centerprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0043197 [CC]dendritic spineprobableGO:0044309, GO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0032279 [CC]asymmetric synapseprobableGO:0005575, GO:0045202
GO:0051649 [BP]establishment of localization in cellprobableGO:0009987, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005085 [MF]guanyl-nucleotide exchange factor activityprobableGO:0030695, GO:0030234, GO:0060589, GO:0003674
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0055037 [CC]recycling endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XSZ, chain A
Confidence level:very confident
Coverage over the Query: 1-56,113-116,130-194
View the alignment between query and template
View the model in PyMOL
Template: 1RE0, chain B
Confidence level:probable
Coverage over the Query: 4-51,123-190
View the alignment between query and template
View the model in PyMOL